Clone IP09061 Report

Search the DGRC for IP09061

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:90
Well:61
Vector:pOT2
Associated Gene/TranscriptCG8117-RA
Protein status:IP09061.pep: gold
Preliminary Size:489
Sequenced Size:789

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8117 2005-01-01 Successful iPCR screen
CG8117 2008-04-29 Release 5.5 accounting
CG8117 2008-08-15 Release 5.9 accounting
CG8117 2008-12-18 5.12 accounting

Clone Sequence Records

IP09061.complete Sequence

789 bp (789 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023150

> IP09061.complete
ACAATCTAAAAATTGTGCTTTCCGGTTTCGTTGAATAAATTCACTAAACT
TTCTTTCGATTTTGCAGCCATGTCCATGGAAATACGCATCAAGTGCCGCG
AGATGTTGGCAACCGCATTGAAATCGGGCAACATGCCACCAGGATGTGGC
GATCCGGATGACATGGCCGCTAAACTGGAGGACGCAATTTACGGCGACTT
GAACGGCTGCAAGGTGAAGTACAAAAATCGCATACGTTCGCGTTTGGCCA
ACTTGCGCGATCCGAAGAATCCAGAGCTGCGCCAGAAGTTCCTATTAGGT
CAAATAACGCCCGAAGAGTTATCCAAGATGACGCCCGAGGAGATGGCCAG
CGATGATATGAAGCAGATGCGCCAGAAGTACGTTCAGGACTCGATCAATG
CGGCACAGATGGCCAAGGTTCAGGGCACCAAGACGGATCAGTTCAAATGC
GAACGCTGCGACAAACGCAACTGCAGCCAATTGCATATCCGTGATGGTGA
CGAGCCCATTATCACCTTTGTGATATGCGACGAGTGCGGCAACCGCTGGA
AGAGCTAGACAACCGTGGAGAGAGTCCCTTGAAGGAGTCACCCGTCTTGG
CTGGATACCAAGCAAACGAACTCACACAATTCACAATATCTCATATCAAT
AAACAGACTGATCTTCCGTTGGCTTCCACAATATGTAAATAATACTTTAA
CAAGAATACATACAACATACAACATACAACATACATATTATGGAAATATA
TTACATGTCATAAAAATCTTAAAAAAAAAAAAAAAAAAA

IP09061.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG8117-RA 770 CG8117-RA 1..770 1..770 3850 100 Plus
TfIIS-RA 1769 TfIIS-RA 953..1069 323..439 270 82 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15534102..15534864 1..770 3710 99.1 Plus
chr2L 23010047 chr2L 15058414..15058530 439..323 255 81.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15644222..15644992 1..771 3855 100 Plus
2L 23513712 2L 15059619..15059735 439..323 270 82.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15652320..15653090 1..771 3855 100 Plus
2L 23513712 2L 15059619..15059735 439..323 270 82 Minus
Blast to na_te.dros performed 2019-03-15 15:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1501..1633 635..767 114 60.9 Plus

IP09061.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:50:46 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15534102..15534864 1..770 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:38:24 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..489 70..558 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:54 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..489 70..558 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:42:57 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..489 70..558 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:02:12 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..489 70..558 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:18:05 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..489 70..558 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:35 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:53 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:42:57 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:02:13 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..489 70..558 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:18:05 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
CG8117-RA 1..770 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:46 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
X 15644222..15644991 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:46 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
X 15644222..15644991 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:50:46 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
X 15644222..15644991 1..770 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:42:57 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15538255..15539024 1..770 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:38:01 Download gff for IP09061.complete
Subject Subject Range Query Range Percent Splice Strand
X 15652320..15653089 1..770 100   Plus

IP09061.pep Sequence

Translation from 69 to 557

> IP09061.pep
MSMEIRIKCREMLATALKSGNMPPGCGDPDDMAAKLEDAIYGDLNGCKVK
YKNRIRSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQM
RQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNCSQLHIRDGDEPIITF
VICDECGNRWKS*

IP09061.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15561-PA 315 GF15561-PA 151..313 1..161 565 60.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17893-PA 162 GG17893-PA 1..162 1..162 692 76.5 Plus
Dere\GG24225-PA 313 GG24225-PA 149..311 1..161 576 62.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10818-PA 350 GH10818-PA 190..348 5..161 565 62.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8117-PA 162 CG8117-PA 1..162 1..162 864 100 Plus
TfIIS-PB 313 CG3710-PB 149..311 1..161 576 63.8 Plus
TfIIS-PA 313 CG3710-PA 149..311 1..161 576 63.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17330-PA 323 GI17330-PA 159..321 1..161 555 60.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25727-PA 313 GL25727-PA 149..311 1..161 564 60.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17632-PA 313 GA17632-PA 149..311 1..161 564 60.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22558-PA 162 GM22558-PA 1..162 1..162 730 80.9 Plus
Dsec\GM14545-PA 311 GM14545-PA 147..309 1..161 583 63.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17224-PA 141 GD17224-PA 1..141 22..162 656 83 Plus
Dsim\GD21972-PA 146 GD21972-PA 22..144 41..161 427 61.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TfIIS-PA 324 GJ15975-PA 160..322 1..161 498 60.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18066-PA 319 GK18066-PA 155..317 1..161 500 60.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17201-PA 162 GE17201-PA 1..162 1..162 687 76.5 Plus
Dyak\GE19417-PA 313 GE19417-PA 149..311 1..161 574 62.6 Plus

IP09061.hyp Sequence

Translation from 69 to 557

> IP09061.hyp
MSMEIRIKCREMLATALKSGNMPPGCGDPDDMAAKLEDAIYGDLNGCKVK
YKNRIRSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQM
RQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNCSQLHIRDGDEPIITF
VICDECGNRWKS*

IP09061.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG8117-PA 162 CG8117-PA 1..162 1..162 864 100 Plus
TfIIS-PB 313 CG3710-PB 149..311 1..161 576 63.8 Plus
TfIIS-PA 313 CG3710-PA 149..311 1..161 576 63.8 Plus