Clone IP09231 Report

Search the DGRC for IP09231

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:92
Well:31
Vector:pOT2
Associated Gene/TranscriptCG12560-RB
Protein status:IP09231.pep: gold
Preliminary Size:795
Sequenced Size:1010

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12560 2008-04-29 Release 5.5 accounting
CG12560 2008-08-15 Release 5.9 accounting
CG12560 2008-12-18 5.12 accounting

Clone Sequence Records

IP09231.complete Sequence

1010 bp assembled on 2007-01-16

GenBank Submission: BT029927

> IP09231.complete
TTGCGAAAGGTTGTCGTCATGTCGACGGAGAATTCGTTGGTTGAAATTCC
ACGCGGCGAATGGACTAAACTGCGAGATTTGTATGTGGCCAGAGATACGG
ATCCCCAAGGCTATCCGTGCATAAATAATTTCATTAAGTGGGTGGAGATA
GACCCGCAATTGAAGGTCAATTTCCTATCGTTGAATGGCGACTGGCAGAG
CGATGGAACCTTTGTTCTAACGCTACGTTCGGATACTCATATGAACCACA
TTTACTTCAACACACTGAGCGAAAATTTGGATCGAGTGACGAAAGCGTTA
GAATGCCTCAAGTCCATTGAGAATGAATACGATTTCTTTGGGTTTTCTAC
GCGATTGAAACCTGTGGTGGAGTATATTGGCAACAAATATTATGCCAACA
AGAAGCTGCACACTGTGGATACCGTTTGGTACGCGGCCAGCAAAGAACTC
GTAGATACATTTAACATTCAGGTTCCTCCGGGCTTAAGTCTACAGCACTT
GACCATCGAAGATGCCGAAATCATCAATGAAAACTGGCCACATAATAAAC
CCGGCTCTATAGACTTTGTGAGAAGTTTAATTAAATATAATATTAATTTG
GGTGCTTATGACGACAAGGGAAAGTTGGTTGCCTGGTGTCTGCGATTGCC
GATTGGATCCCTGGGTCTGCTGCAGGTTCTGGAGTCACATAAACGCCTTG
GTCTCGGCAGCTTGCTGGTGAAGTCGATGGCTAAGAAGATTTCCGCAGCG
GGAGATCAAGTTTTGGCGCCAGTAGTAACGAAGAACACCCCCTCGAGGAG
CATGTTCGAGAAACTGGGTTTCCGTGCTATAGACAATACATACTGGGCTG
CCTAGCAACTGAGAAGAAGCCAAAAACTAACATAAATATTATTAAAATAA
ATATAGTGTAGGAAATGATTGGTTTTTTAATAATAAAGAAGAGTGAATCA
GCTCATTCAATTATAGCTGAGCACCCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

IP09231.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12560-RB 1028 CG12560-RB 41..1017 1..977 4885 100 Plus
CG12560.a 981 CG12560.a 494..981 489..976 2440 100 Plus
CG12560.a 981 CG12560.a 24..493 1..470 2350 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8007341..8007673 976..644 1665 100 Minus
chr2L 23010047 chr2L 8007967..8008216 471..222 1235 99.6 Minus
chr2L 23010047 chr2L 8008269..8008497 229..1 1100 98.7 Minus
chr2L 23010047 chr2L 8007738..8007911 644..471 870 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8008320..8008653 977..644 1670 100 Minus
2L 23513712 2L 8008947..8009196 471..222 1250 100 Minus
2L 23513712 2L 8009249..8009477 229..1 1115 99.1 Minus
2L 23513712 2L 8008718..8008891 644..471 870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8008320..8008653 977..644 1670 100 Minus
2L 23513712 2L 8008947..8009196 471..222 1250 100 Minus
2L 23513712 2L 8009249..8009477 229..1 1115 99.1 Minus
2L 23513712 2L 8008718..8008891 644..471 870 100 Minus
Blast to na_te.dros performed 2019-03-15 21:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 495..571 875..950 112 62.3 Plus

IP09231.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:52:24 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8007341..8007672 645..976 92 <- Minus
chr2L 8007738..8007911 471..644 86 <- Minus
chr2L 8007968..8008215 223..470 99 <- Minus
chr2L 8008276..8008497 1..222 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:38:41 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RA 1..411 19..429 100 == Plus
CG12560-RA 412..795 472..855 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:09:49 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RB 1..837 19..855 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:01:19 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RB 1..837 19..855 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:19:59 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RA 1..411 19..429 100 == Plus
CG12560-RA 412..795 472..855 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:05:28 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RB 1..837 19..855 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:38:54 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RA 1..411 19..429 100 == Plus
CG12560-RA 412..795 472..855 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:09:49 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RB 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:01:19 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RB 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:58 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RA 1..411 19..429 100 == Plus
CG12560-RA 412..795 472..855 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:05:28 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
CG12560-RB 1..976 1..976 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:24 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8008321..8008652 645..976 100 <- Minus
2L 8008718..8008891 471..644 100 <- Minus
2L 8008948..8009195 223..470 100 <- Minus
2L 8009256..8009477 1..222 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:24 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8008321..8008652 645..976 100 <- Minus
2L 8008718..8008891 471..644 100 <- Minus
2L 8008948..8009195 223..470 100 <- Minus
2L 8009256..8009477 1..222 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:24 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8008321..8008652 645..976 100 <- Minus
2L 8008718..8008891 471..644 100 <- Minus
2L 8008948..8009195 223..470 100 <- Minus
2L 8009256..8009477 1..222 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:01:19 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8008948..8009195 223..470 100 <- Minus
arm_2L 8008321..8008652 645..976 100 <- Minus
arm_2L 8008718..8008891 471..644 100 <- Minus
arm_2L 8009256..8009477 1..222 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:42:08 Download gff for IP09231.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8009256..8009477 1..222 100   Minus
2L 8008321..8008652 645..976 100 <- Minus
2L 8008718..8008891 471..644 100 <- Minus
2L 8008948..8009195 223..470 100 <- Minus

IP09231.hyp Sequence

Translation from 0 to 854

> IP09231.hyp
LRKVVVMSTENSLVEIPRGEWTKLRDLYVARDTDPQGYPCINNFIKWVEI
DPQLKVNFLSLNGDWQSDGTFVLTLRSDTHMNHIYFNTLSENLDRVTKAL
ECLKSIENEYDFFGFSTRLKPVVEYIGNKYYANKKLHTVDTVWYAASKEL
VDTFNIQVPPGLSLQHLTIEDAEIINENWPHNKPGSIDFVRSLIKYNINL
GAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAA
GDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYWAA*

IP09231.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG12560-PB 278 CG12560-PB 1..278 7..284 1468 100 Plus
CG12560-PC 272 CG12560-PC 1..272 7..284 1414 97.5 Plus
CG34010-PA 278 CG34010-PA 6..272 16..283 396 32.5 Plus
CG17681-PA 293 CG17681-PA 33..277 37..283 348 33.6 Plus
CG5783-PA 287 CG5783-PA 29..271 36..282 302 31.3 Plus

IP09231.pep Sequence

Translation from 18 to 854

> IP09231.pep
MSTENSLVEIPRGEWTKLRDLYVARDTDPQGYPCINNFIKWVEIDPQLKV
NFLSLNGDWQSDGTFVLTLRSDTHMNHIYFNTLSENLDRVTKALECLKSI
ENEYDFFGFSTRLKPVVEYIGNKYYANKKLHTVDTVWYAASKELVDTFNI
QVPPGLSLQHLTIEDAEIINENWPHNKPGSIDFVRSLIKYNINLGAYDDK
GKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLA
PVVTKNTPSRSMFEKLGFRAIDNTYWAA*

IP09231.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15332-PA 277 GF15332-PA 1..276 1..277 1077 70.4 Plus
Dana\GF19707-PA 212 GF19707-PA 4..210 73..278 326 34.6 Plus
Dana\GF14490-PA 293 GF14490-PA 1..277 1..277 313 31.4 Plus
Dana\GF14492-PA 284 GF14492-PA 27..268 30..276 289 30.7 Plus
Dana\GF14491-PA 271 GF14491-PA 7..255 8..276 244 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23486-PA 281 GG23486-PA 1..277 1..277 1207 80.5 Plus
Dere\GG21112-PA 287 GG21112-PA 29..271 30..276 316 32.1 Plus
Dere\GG21109-PA 293 GG21109-PA 33..277 31..277 312 32.8 Plus
Dere\GG23485-PA 101 GG23485-PA 1..90 188..277 239 52.2 Plus
Dere\GG17517-PA 304 GG17517-PA 161..289 146..269 207 34.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11463-PA 280 GH11463-PA 9..277 5..276 786 54.4 Plus
Dgri\GH11464-PA 279 GH11464-PA 9..277 5..276 772 52.6 Plus
Dgri\GH11461-PA 285 GH11461-PA 24..280 5..276 730 50.9 Plus
Dgri\GH11462-PA 213 GH11462-PA 1..207 70..276 353 38 Plus
Dgri\GH11205-PA 288 GH11205-PA 31..272 32..276 342 32.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12560-PB 278 CG12560-PB 1..278 1..278 1468 100 Plus
CG12560-PC 272 CG12560-PC 1..272 1..278 1414 97.5 Plus
Glyat-PA 278 CG34010-PA 6..272 10..277 396 32.5 Plus
CG17681-PA 293 CG17681-PA 33..277 31..277 348 33.6 Plus
CG5783-PA 287 CG5783-PA 29..271 30..276 302 31.3 Plus
CG14615-PB 304 CG14615-PB 170..289 152..269 194 32.2 Plus
CG14615-PA 304 CG14615-PA 170..289 152..269 194 32.2 Plus
CG15155-PB 257 CG15155-PB 126..247 135..276 192 32.4 Plus
CG15155-PA 258 CG15155-PA 127..248 135..276 192 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16891-PA 265 GI16891-PA 6..264 5..277 650 46.9 Plus
Dmoj\GI18127-PA 287 GI18127-PA 31..271 32..276 316 31.5 Plus
Dmoj\GI18126-PA 285 GI18126-PA 27..270 30..277 314 32.9 Plus
Dmoj\GI16884-PA 213 GI16884-PA 9..204 78..273 311 37.1 Plus
Dmoj\GI18125-PA 292 GI18125-PA 12..276 13..277 303 30.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18506-PA 274 GL18506-PA 2..273 5..277 919 61.5 Plus
Dper\GL18697-PA 287 GL18697-PA 31..271 32..276 322 32 Plus
Dper\GL18695-PA 293 GL18695-PA 1..277 1..277 300 29.6 Plus
Dper\GL18505-PA 138 GL18505-PA 5..127 154..277 267 41.1 Plus
Dper\GL18696-PA 286 GL18696-PA 131..272 138..278 252 36.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25663-PA 286 GA25663-PA 158..285 150..277 455 63.3 Plus
Dpse\GA19124-PA 287 GA19124-PA 31..271 32..276 320 32.8 Plus
Dpse\GA14610-PA 293 GA14610-PA 1..277 1..277 302 29.9 Plus
Dpse\GA25759-PA 285 GA25759-PA 130..271 138..278 251 35.9 Plus
Dpse\GA13114-PA 305 GA13114-PA 75..290 56..268 200 28.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13211-PA 277 GM13211-PA 1..276 1..277 1329 89.9 Plus
Dsec\GM17267-PA 291 GM17267-PA 31..275 31..277 335 32.8 Plus
Dsec\GM17269-PA 287 GM17269-PA 29..271 30..276 317 32 Plus
Dsec\GM13208-PA 161 GM13208-PA 16..155 138..277 288 38.6 Plus
Dsec\GM11726-PA 304 GM11726-PA 161..289 146..269 203 34.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22448-PA 278 GD22448-PA 1..277 1..277 1341 89.5 Plus
Dsim\GD24132-PA 395 GD24132-PA 33..277 31..277 339 33.6 Plus
Dsim\GD24134-PA 287 GD24134-PA 29..271 30..276 316 32.6 Plus
Dsim\GD22447-PA 103 GD22447-PA 1..97 181..277 253 49.5 Plus
Dsim\GD24428-PA 283 GD24428-PA 140..268 146..269 186 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17205-PA 281 GJ17205-PA 9..279 5..276 760 54.6 Plus
Dvir\GJ17752-PA 287 GJ17752-PA 31..271 32..276 331 34.2 Plus
Dvir\GJ17204-PA 352 GJ17204-PA 175..347 106..277 312 39.3 Plus
Dvir\GJ17749-PA 292 GJ17749-PA 31..276 31..277 311 32.2 Plus
Dvir\GJ17751-PA 285 GJ17751-PA 27..269 30..276 307 29.5 Plus
Dvir\GJ17204-PA 352 GJ17204-PA 10..148 5..144 305 44 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15128-PA 339 GK15128-PA 8..336 6..277 680 42.7 Plus
Dwil\GK15541-PA 288 GK15541-PA 29..272 30..276 310 31.6 Plus
Dwil\GK15539-PA 289 GK15539-PA 1..263 1..269 300 31.8 Plus
Dwil\GK16280-PA 302 GK16280-PA 66..288 49..269 207 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11237-PA 278 GE11237-PA 1..277 1..277 1138 76.2 Plus
Dyak\GE11235-PA 264 GE11235-PA 1..263 1..277 1089 77.3 Plus
Dyak\GE11230-PA 278 GE11230-PA 2..272 4..277 405 33.8 Plus
Dyak\GE13182-PA 293 GE13182-PA 1..277 1..277 301 31.2 Plus
Dyak\GE13184-PA 287 GE13184-PA 29..271 30..276 297 31.1 Plus