Clone IP09309 Report

Search the DGRC for IP09309

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:93
Well:9
Vector:pOT2
Associated Gene/TranscriptCG10469-RA
Protein status:IP09309.pep: gold
Preliminary Size:804
Sequenced Size:919

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10469 2005-01-01 Successful iPCR screen
CG10469 2008-04-29 Release 5.5 accounting
CG10469 2008-08-15 Release 5.9 accounting
CG10469 2008-12-18 5.12 accounting

Clone Sequence Records

IP09309.complete Sequence

919 bp (919 high quality bases) assembled on 2005-01-27

GenBank Submission: BT023154

> IP09309.complete
AAAACCACGAATACGGGCAATATATAAAGCTGTTCAAGGGTTTGGAGTTG
TAAATCAATTGAAATGATTCTCCAGCTGGTGCTTATCGTGCAGTTCTCCC
TGGTATTTGGCCAGGAGACTGGCTCCCTGCGAATAATGAATGGCACAGCG
GCAAAAGCGAAGCAGTTGCCTTACCAGGTTGGACTACTTTGCTACTTCGA
AGGATCCAAGGATGAGCCCAATATGTGCGGGGGCACTATCCTCAGTAATC
GTTGGATTATAACCGCAGCCCATTGTCTGCAGGATCCAAAGTCTAATCTC
TGGAAAGTGCTGATCCACGTGGGAAAGGTGAAATCCTTTGATGATAAAGA
AATCGTGGTCAACCGGAGCTACACCATCGTCCACAAGAAGTTCGACCGTA
AGACCGTGACAAACGATATAGCCCTGATCAAATTACCCAAGAAGCTTACA
TTTAACAAGTATATCCAACCCGCCAAGTTGCCCAGTGCCAAGAAAACATA
CACGGGTCGCAAAGCCATCATTTCGGGTTGGGGTCTGACCACCAAGCAGC
TGCCCAGCCAGGTGCTCCAGTACATCAGGGCGCCCATCATCTCGAACAAG
GAGTGCGAGAGGCAGTGGAACAAGCAGCTGGGCGGCAAAAGCAAAAAGGT
CGTGCACAACGGCTTCATCTGCATCGATTCCAAGAAGGGTCTGCCATGTC
GCGGCGACTCCGGAGGTCCGATGGTCTTGGACGATGGCAGCAGAACCCTG
GTGGGAATTGTATCCCACGGATTCGATGGCGAGTGCAAGCTAAAACTGCC
CGACGTATCCACACGCGTTTCTTCCTACCTCAAGTGGATTAAATACTACT
CTGGAGGACTTAAGTAGTTGATGTGGAATCATTAAAAATCGAATCTCTTT
TCAAAAAAAAAAAAAAAAA

IP09309.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG10469-RA 1190 CG10469-RA 289..1190 1..902 4510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6084847..6085449 902..300 2820 97.8 Minus
chr3L 24539361 chr3L 6085509..6085807 299..1 1420 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6092185..6092790 905..300 3030 100 Minus
3L 28110227 3L 6092850..6093148 299..1 1495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6085285..6085890 905..300 3030 100 Minus
3L 28103327 3L 6085950..6086248 299..1 1495 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:07:46 has no hits.

IP09309.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:08:59 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6084847..6085449 300..902 97 <- Minus
chr3L 6085509..6085807 1..299 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:20 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 1..804 64..867 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:42:22 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 1..804 64..867 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:19 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 1..804 64..867 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:25 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 1..804 64..867 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:21 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 1..804 64..867 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:20 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 166..1067 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:42:22 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 166..1067 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:19 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 1..804 64..867 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:25 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
CG10469-RA 166..1067 1..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:08:59 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6092188..6092790 300..902 100 <- Minus
3L 6092850..6093148 1..299 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:08:59 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6092188..6092790 300..902 100 <- Minus
3L 6092850..6093148 1..299 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:08:59 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6092188..6092790 300..902 100 <- Minus
3L 6092850..6093148 1..299 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:42:22 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6085288..6085890 300..902 100 <- Minus
arm_3L 6085950..6086248 1..299 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:23 Download gff for IP09309.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6085288..6085890 300..902 100 <- Minus
3L 6085950..6086248 1..299 100   Minus

IP09309.pep Sequence

Translation from 63 to 866

> IP09309.pep
MILQLVLIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKD
EPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVN
RSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRK
AIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNG
FICIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVST
RVSSYLKWIKYYSGGLK*

IP09309.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10928-PA 266 GF10928-PA 1..266 1..267 905 61 Plus
Dana\GF23751-PA 292 GF23751-PA 46..286 21..264 481 43.5 Plus
Dana\GF20121-PA 270 GF20121-PA 4..265 3..264 473 40.3 Plus
Dana\GF10540-PA 276 GF10540-PA 28..262 24..259 385 37.8 Plus
Dana\GF10663-PA 274 GF10663-PA 34..271 16..264 367 37.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14089-PA 267 GG14089-PA 1..267 1..267 1240 85.8 Plus
Dere\GG14091-PA 290 GG14091-PA 46..284 23..264 478 43.5 Plus
Dere\GG13625-PA 270 GG13625-PA 27..260 24..259 391 39.4 Plus
Dere\GG14094-PA 272 GG14094-PA 39..269 23..264 389 38 Plus
Dere\GG15569-PA 285 GG15569-PA 36..261 30..265 368 37.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15659-PA 273 GH15659-PA 21..273 20..266 725 53.9 Plus
Dgri\GH15658-PA 268 GH15658-PA 20..268 24..266 565 45.5 Plus
Dgri\GH16446-PA 290 GH16446-PA 46..284 23..264 421 37.9 Plus
Dgri\GH16119-PA 263 GH16119-PA 22..259 23..264 373 37.5 Plus
Dgri\GH16120-PA 254 GH16120-PA 12..246 23..259 363 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10469-PA 267 CG10469-PA 1..267 1..267 1405 100 Plus
CG10472-PA 290 CG10472-PA 37..284 14..264 458 43.5 Plus
CG7542-PB 270 CG7542-PB 27..260 24..259 360 38.2 Plus
CG7542-PA 270 CG7542-PA 27..260 24..259 360 38.2 Plus
CG11529-PA 287 CG11529-PA 25..256 19..260 355 36.1 Plus
CG10477-PB 272 CG10477-PB 39..269 23..264 343 37.3 Plus
CG10477-PA 272 CG10477-PA 39..269 23..264 343 37.3 Plus
CG8172-PD 371 CG8172-PD 121..362 19..259 335 35.7 Plus
CG8172-PE 545 CG8172-PE 295..536 19..259 335 35.7 Plus
CG8172-PF 561 CG8172-PF 311..552 19..259 335 35.7 Plus
yip7-PA 270 CG6457-PA 39..269 23..264 330 36.9 Plus
Jon65Aiii-PA 274 CG6483-PA 39..271 23..264 312 35.7 Plus
Jon65Aiv-PA 271 CG6467-PA 37..270 23..264 311 33.9 Plus
Jon74E-PC 271 CG6298-PC 1..267 1..264 310 30.8 Plus
CG3355-PA 314 CG3355-PA 75..303 23..260 310 30.5 Plus
l(2)k05911-PC 639 CG31728-PC 399..634 23..259 310 35.7 Plus
Jon99Cii-PA 265 CG31034-PA 35..262 23..264 305 35.5 Plus
Jon99Ciii-PB 265 CG31362-PB 35..262 23..264 305 35.5 Plus
Jon99Ciii-PA 265 CG31362-PA 35..262 23..264 305 35.5 Plus
lint-PB 1674 CG8213-PB 1459..1672 53..264 301 35.5 Plus
lint-PC 1693 CG8213-PC 1478..1691 53..264 301 35.5 Plus
CG4914-PA 374 CG4914-PA 120..360 16..259 293 32.8 Plus
CG31954-PA 277 CG31954-PA 50..276 23..264 290 32.4 Plus
Jon99Fii-PA 267 CG2229-PA 37..264 23..264 289 33.9 Plus
CG11836-PI 281 CG11836-PI 37..271 16..260 289 31.7 Plus
CG11836-PJ 333 CG11836-PJ 89..323 16..260 289 31.7 Plus
Jon99Fi-PA 267 CG18030-PA 37..264 23..264 288 33.9 Plus
Jon44E-PB 271 CG8579-PB 40..268 23..264 288 35.1 Plus
Jon44E-PA 271 CG8579-PA 40..268 23..264 288 35.1 Plus
CG6592-PA 438 CG6592-PA 122..362 23..264 285 31.5 Plus
CG11836-PF 223 CG11836-PF 12..213 55..260 281 34.3 Plus
CG11836-PE 223 CG11836-PE 12..213 55..260 281 34.3 Plus
CG11836-PG 223 CG11836-PG 12..213 55..260 281 34.3 Plus
CG11836-PC 223 CG11836-PC 12..213 55..260 281 34.3 Plus
CG11836-PA 223 CG11836-PA 12..213 55..260 281 34.3 Plus
CG11836-PB 223 CG11836-PB 12..213 55..260 281 34.3 Plus
CG32260-PC 395 CG32260-PC 145..389 21..260 281 32.8 Plus
CG32260-PA 575 CG32260-PA 325..569 21..260 281 32.8 Plus
CG32808-PA 284 CG32808-PA 29..255 23..259 280 31.4 Plus
Sb-PB 787 CG4316-PB 543..782 23..259 277 30.2 Plus
Sb-PA 787 CG4316-PA 543..782 23..259 277 30.2 Plus
CG4998-PA 891 CG4998-PA 653..884 34..260 275 32.4 Plus
CG4998-PB 1185 CG4998-PB 947..1178 34..260 275 32.4 Plus
CG6865-PB 285 CG6865-PB 10..285 2..267 273 29.9 Plus
CG11911-PA 277 CG11911-PA 37..266 24..259 271 29.9 Plus
Np-PB 1041 CG34350-PB 797..1035 23..259 270 33.1 Plus
Jon25Bi-PB 266 CG8867-PB 36..262 23..264 269 33.7 Plus
Jon25Bii-PB 276 CG8869-PB 31..273 14..264 269 33 Plus
Jon25Bii-PA 276 CG8869-PA 31..273 14..264 269 33 Plus
CG8952-PA 276 CG8952-PA 37..273 23..264 267 31.8 Plus
CG31265-PA 266 CG31265-PA 36..255 23..260 261 32.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21872-PA 275 GI21872-PA 4..272 2..266 660 51.3 Plus
Dmoj\GI12704-PA 275 GI12704-PA 4..272 2..266 660 51.3 Plus
Dmoj\GI16701-PA 290 GI16701-PA 32..284 9..264 475 40.8 Plus
Dmoj\GI12385-PA 264 GI12385-PA 23..260 23..264 410 39.9 Plus
Dmoj\GI16676-PA 273 GI16676-PA 37..266 23..260 385 37.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15524-PA 270 GL15524-PA 1..267 1..265 987 68.9 Plus
Dper\GL15526-PA 289 GL15526-PA 40..283 16..264 481 42.3 Plus
Dper\GL25139-PA 270 GL25139-PA 29..265 23..260 376 36.1 Plus
Dper\GL25036-PA 263 GL25036-PA 3..260 7..264 370 33.8 Plus
Dper\GL25164-PA 309 GL25164-PA 41..267 30..266 369 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10333-PA 270 GA10333-PA 1..267 1..265 986 68.9 Plus
Dpse\GA10335-PA 289 GA10335-PA 40..283 16..264 489 42.3 Plus
Dpse\GA24722-PA 276 GA24722-PA 24..272 20..265 431 40 Plus
Dpse\GA20426-PA 270 GA20426-PA 29..265 23..260 376 36.1 Plus
Dpse\GA23594-PA 263 GA23594-PA 3..260 7..264 370 33.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13872-PA 267 GM13872-PA 1..267 1..267 1382 97 Plus
Dsec\GM13874-PA 290 GM13874-PA 37..284 14..264 477 43.5 Plus
Dsec\GM25710-PA 270 GM25710-PA 27..260 24..259 364 37.3 Plus
Dsec\GM13877-PA 272 GM13877-PA 39..269 23..264 364 37.8 Plus
Dsec\GM25336-PA 288 GM25336-PA 25..261 19..265 355 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13156-PA 267 GD13156-PA 1..267 1..267 1381 97.4 Plus
Dsim\GD13158-PA 290 GD13158-PA 37..284 14..264 473 43.1 Plus
Dsim\GD13918-PA 272 GD13918-PA 39..269 23..264 361 39 Plus
Dsim\GD13161-PA 272 GD13161-PA 39..269 23..264 360 37.9 Plus
Dsim\GD14368-PA 288 GD14368-PA 25..261 19..265 357 36.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12687-PA 280 GJ12687-PA 25..277 20..266 779 57.5 Plus
Dvir\GJ12437-PA 290 GJ12437-PA 46..284 23..264 461 40.7 Plus
Dvir\GJ12274-PA 263 GJ12274-PA 22..259 23..264 404 37.9 Plus
Dvir\GJ13566-PA 274 GJ13566-PA 5..267 2..260 404 38 Plus
Dvir\GJ12275-PA 264 GJ12275-PA 14..250 21..259 388 35.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19270-PA 269 GK19270-PA 7..267 6..265 785 55.6 Plus
Dwil\GK17275-PA 297 GK17275-PA 51..287 21..260 469 41.8 Plus
Dwil\GK17276-PA 290 GK17276-PA 48..284 23..264 420 39.9 Plus
Dwil\GK17178-PA 270 GK17178-PA 5..263 1..260 398 35.7 Plus
Dwil\GK18044-PA 273 GK18044-PA 29..270 13..264 366 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20512-PA 267 GE20512-PA 1..266 1..266 1216 85 Plus
Dyak\GE20514-PA 290 GE20514-PA 37..284 14..264 464 42.4 Plus
Dyak\GE19921-PA 270 GE19921-PA 27..260 24..259 380 38.6 Plus
Dyak\GE22139-PA 260 GE22139-PA 3..259 6..264 362 34.9 Plus
Dyak\GE22140-PA 260 GE22140-PA 3..259 6..264 361 34.9 Plus

IP09309.hyp Sequence

Translation from 63 to 866

> IP09309.hyp
MILQLVLIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKD
EPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVN
RSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRK
AIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNG
FICIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVST
RVSSYLKWIKYYSGGLK*

IP09309.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG10469-PA 267 CG10469-PA 1..267 1..267 1405 100 Plus
CG10472-PA 290 CG10472-PA 37..284 14..264 458 43.5 Plus
CG7542-PB 270 CG7542-PB 27..260 24..259 360 38.2 Plus
CG7542-PA 270 CG7542-PA 27..260 24..259 360 38.2 Plus
CG11529-PA 287 CG11529-PA 25..256 19..260 355 36.1 Plus