Clone IP09318 Report

Search the DGRC for IP09318

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:93
Well:18
Vector:pOT2
Associated Gene/Transcriptsa-RA
Protein status:IP09318.pep: gold
Preliminary Size:828
Sequenced Size:973

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
sa 2008-04-29 Release 5.5 accounting
sa 2008-08-15 Release 5.9 accounting
sa 2008-12-18 5.12 accounting

Clone Sequence Records

IP09318.complete Sequence

973 bp (973 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023594

> IP09318.complete
CTTCGTTTTAACAGTCAGTCGAATCGAGTGATTTGCCCAAAAATGAATAC
CTACGACGAAGTCTTGGCAACAGTGCTGGACAATTTGCTGGCATCCAAGA
ACTGTGAGGTGGTCGACGACGTACTGCGTCAGTCGATGCTGGAACTTTTG
CGTGGCAAATTCCGTGAGATTGCACGTCAGACTACCAATTGGTCCAATCA
CGCTGGTCGCTGTGCACCCAGCTACTTCGATCTGGAGCGCACCTTCATCC
GGATGAACATCAAGGTGGGCGAGCTAAAGGCCATGTACGAGGGTCAACCG
GATTCGTTGGTCTTGGTTGAGTGCAATGCACCGGAGACACAAGACCAGGA
CTTCCACAGTGTGCCGCAACCCGTGCTGAGCTCCACAAAGGCCGTGGAAT
TGGCCTCCACCACGTATATTCCGGACCATTTGCCACCATTTCCAGGGGCG
CACACCTATAAGAGTTCGACCATTGAGAAGGTTACGGATCGCAGCTATGT
GGCCATGAGGAATCGCCATGCCGAGAATGAGCTGAACACCCAAAACGCCT
TAAATCAATACTACCTGAGGTGCAACCCCAATATATCGCTGTTCGAAGAA
ACCCAACGCGATGGAAGTGGCCACGTTTTGGATCTAGGTCCACCCAAGAA
ACTTCCTTATTCGGACGCCCTGATGCCAAGAAATCAGGTCTTTGATACGG
ACATCTATGCTCCCATCGAGGTGATAACCCACAAAGCCCTCGACTGCCGT
TACTTGGAGAAGCCCAAGTTGCACAGTTCACGCCCATCCTCAGGAAATTT
CGAAGAGGAAGACGTGGAAATGGAGGAGCCCTGCAGTCCAGGGGGACTAG
GTATTGAAAAACCGAATTAAACTGCAGCTCAGTAAGAGGTGAAAAGCACA
CGAAATGTTTCCATTGCCAGACCAAGCTACTCCACGGAATAAAGTGTGAA
AAAATTAAAAAAAAAAAAAAAAA

IP09318.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:19
Subject Length Description Subject Range Query Range Score Percent Strand
sa-RA 1150 sa-RA 89..1046 1..958 4790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21394948..21395526 736..158 2895 100 Minus
chr3L 24539361 chr3L 21394433..21394654 956..735 1110 100 Minus
chr3L 24539361 chr3L 21395590..21395746 157..1 785 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21405940..21406518 736..158 2895 100 Minus
3L 28110227 3L 21405423..21405646 958..735 1120 100 Minus
3L 28110227 3L 21406582..21406738 157..1 785 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21399040..21399618 736..158 2895 100 Minus
3L 28103327 3L 21398523..21398746 958..735 1120 100 Minus
3L 28103327 3L 21399682..21399838 157..1 785 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:08:16 has no hits.

IP09318.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:09:21 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21395590..21395746 1..157 100   Minus
chr3L 21394433..21394652 737..956 100 <- Minus
chr3L 21394948..21395526 158..736 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:39:07 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..828 43..870 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:16 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..828 43..870 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:53:45 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..828 43..870 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:48 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..828 43..870 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:30 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..828 43..870 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:44:49 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..828 43..870 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:15 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 38..993 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:53:45 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..956 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:48 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..828 43..870 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:30 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
sa-RA 1..956 1..956 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:21 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21405425..21405644 737..956 100 <- Minus
3L 21405940..21406518 158..736 100 <- Minus
3L 21406582..21406738 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:21 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21405425..21405644 737..956 100 <- Minus
3L 21405940..21406518 158..736 100 <- Minus
3L 21406582..21406738 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:21 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21405425..21405644 737..956 100 <- Minus
3L 21405940..21406518 158..736 100 <- Minus
3L 21406582..21406738 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:53:45 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21398525..21398744 737..956 100 <- Minus
arm_3L 21399040..21399618 158..736 100 <- Minus
arm_3L 21399682..21399838 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:46 Download gff for IP09318.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21398525..21398744 737..956 100 <- Minus
3L 21399040..21399618 158..736 100 <- Minus
3L 21399682..21399838 1..157 100   Minus

IP09318.hyp Sequence

Translation from 0 to 869

> IP09318.hyp
LRFNSQSNRVICPKMNTYDEVLATVLDNLLASKNCEVVDDVLRQSMLELL
RGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMNIKVGELKAMYEGQP
DSLVLVECNAPETQDQDFHSVPQPVLSSTKAVELASTTYIPDHLPPFPGA
HTYKSSTIEKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEE
TQRDGSGHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDCR
YLEKPKLHSSRPSSGNFEEEDVEMEEPCSPGGLGIEKPN*

IP09318.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
sa-PA 275 CG11308-PA 1..275 15..289 1455 100 Plus

IP09318.pep Sequence

Translation from 0 to 869

> IP09318.pep
LRFNSQSNRVICPKMNTYDEVLATVLDNLLASKNCEVVDDVLRQSMLELL
RGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMNIKVGELKAMYEGQP
DSLVLVECNAPETQDQDFHSVPQPVLSSTKAVELASTTYIPDHLPPFPGA
HTYKSSTIEKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEE
TQRDGSGHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDCR
YLEKPKLHSSRPSSGNFEEEDVEMEEPCSPGGLGIEKPN*

IP09318.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24194-PA 313 GF24194-PA 1..262 15..277 650 49.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13239-PA 263 GG13239-PA 1..262 15..276 1015 71.8 Plus
Dere\GG19150-PA 328 GG19150-PA 7..217 10..232 152 22.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14693-PA 251 GH14693-PA 1..242 15..255 345 35.7 Plus
Dgri\GH17580-PA 332 GH17580-PA 7..249 10..276 154 22.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
sa-PA 275 CG11308-PA 1..275 15..289 1455 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13306-PA 799 GI13306-PA 1..244 15..256 409 38.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24583-PA 541 GL24583-PA 1..221 15..236 343 36.1 Plus
Dper\GL14948-PA 323 GL14948-PA 7..217 10..232 152 24.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10905-PA 1081 GA10905-PA 1..221 15..236 346 37 Plus
Dpse\GA20122-PA 323 GA20122-PA 7..254 10..276 152 23.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22142-PA 275 GM22142-PA 1..275 15..289 1336 89.8 Plus
Dsec\GM22880-PA 330 GM22880-PA 7..249 10..276 158 23.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12120-PA 275 GD12120-PA 1..275 15..289 1350 90.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12076-PA 304 GJ12076-PA 1..240 15..255 488 42.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20419-PA 294 GK20419-PA 1..212 15..226 239 28.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22337-PA 278 GE22337-PA 1..270 15..284 1094 75.6 Plus
Dyak\GE22713-PA 278 GE22713-PA 1..270 15..284 1085 74.8 Plus
Dyak\GE17709-PA 328 GE17709-PA 7..217 10..232 151 22.4 Plus