BDGP Sequence Production Resources |
Search the DGRC for IP09347
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 93 |
Well: | 47 |
Vector: | pOT2 |
Associated Gene/Transcript | Nse4-RB |
Protein status: | IP09347.pep: gold |
Preliminary Size: | 810 |
Sequenced Size: | 1051 |
Gene | Date | Evidence |
---|---|---|
CG13142 | 2008-04-29 | Release 5.5 accounting |
CG13142 | 2008-08-15 | Release 5.9 accounting |
CG13142 | 2008-12-18 | 5.12 accounting |
1051 bp (1051 high quality bases) assembled on 2005-06-08
GenBank Submission: BT023592
> IP09347.complete CAGAAATCATTTTCAAAGAAATTTGTTTATGTGAATTCACAATTGGATTA ACTTCGCTCTTCTTTGTTTAGTATTTATTTAACAATAATATGGATTCGTC TGAAAGCCAATCGCAAATGGATGACCAAGATGCTCGCATACTGCGTCTGC AAAATCTGATCGAAAAGAATATTGAGATAGAGCAACAAATCGAAAACAAC ACCATCGGAGAGTCTATCACGGCCATAGAGGAAATCATTCAGACAGCCAA CGATATCAGCAAGGGACATGAAGACCGCCGTACAAACTCCACGGAACTTG TCCTGGACACGGAGCTACTGCGTCGCAATTTCGAAGTTGTGGGAAAAGCT ATCCAACATAACACCAACGTCACGGATCGAATGGTGGCCACGGCGATCAA CGATTTGGTTTTCAAAGAGAGCGAAGAAGATTGGGATGCTCTTTGTTCAT TGGCTATTCAGTTCGGAAGACCACTCTTCACCAATGATAGCATGCTGCCC TTCATAGATGTTACTCCAAAGGTGGTGGTTCAAAAGCAACGTGCTCCTCG CAAAACGAAATCTCAAGTAGATGAGAAGCGTCCAGAAAAGAGTGACCAAT TGGAACGCAAGGACGAAGGAGCAGCGTCCGTAACCCACATGCTGAAGCAA ATAAGACAAATATATCGAGATGGCAATCAAGAGCCGATTCCGTACTTTAA ACTGATTTGCAATCCAAACAATTTTATGGACACCGTTCAGAACGCTTTGC AACTGTCGTTTCTTGTCAAGGAGAACTATATTTCCATCGAAAATGGCGAG GATGGTTTGCCATTGGTTCGCGTTGTGAATTCCAAATCGGTCGAAGGAAA CGCACCGTCCCAGGCTATTTGTTCCATCGATGTTACCTTTTGTGAGAAAA TGGTAAAGCACTACAACCTACATGAGCCAATGTTAAAAAGACTTCCGGTT AGTGAGAAATAGATATATCACTTAGTTCATATTAATAGTTTATATTGTTA TTAATAAAACACATAGAACGTTTAAAGTTAAAAAAAAAAAAAAAAAAAAA A
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10439011..10439340 | 567..896 | 1650 | 100 | Plus |
chr2L | 23010047 | chr2L | 10438504..10438723 | 179..398 | 1100 | 100 | Plus |
chr2L | 23010047 | chr2L | 10438275..10438454 | 1..180 | 885 | 99.4 | Plus |
chr2L | 23010047 | chr2L | 10438780..10438950 | 399..569 | 855 | 100 | Plus |
chr2L | 23010047 | chr2L | 10439394..10439528 | 895..1029 | 675 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10440176..10440505 | 567..896 | 1650 | 100 | Plus |
2L | 23513712 | 2L | 10439669..10439888 | 179..398 | 1100 | 100 | Plus |
2L | 23513712 | 2L | 10439440..10439619 | 1..180 | 900 | 100 | Plus |
2L | 23513712 | 2L | 10439945..10440115 | 399..569 | 855 | 100 | Plus |
2L | 23513712 | 2L | 10440559..10440694 | 895..1030 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10440176..10440505 | 567..896 | 1650 | 100 | Plus |
2L | 23513712 | 2L | 10439669..10439888 | 179..398 | 1100 | 100 | Plus |
2L | 23513712 | 2L | 10439440..10439619 | 1..180 | 900 | 100 | Plus |
2L | 23513712 | 2L | 10439945..10440115 | 399..569 | 855 | 100 | Plus |
2L | 23513712 | 2L | 10440559..10440694 | 895..1030 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 611..664 | 98..43 | 130 | 75 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10438275..10438454 | 1..180 | 99 | -> | Plus |
chr2L | 10438506..10438723 | 181..398 | 100 | -> | Plus |
chr2L | 10438780..10438947 | 399..566 | 100 | -> | Plus |
chr2L | 10439011..10439340 | 567..896 | 100 | -> | Plus |
chr2L | 10439396..10439528 | 897..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RB | 1..873 | 90..962 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RC | 1..873 | 90..962 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RB | 1..873 | 90..962 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RB | 1..873 | 90..962 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nse4-RB | 1..873 | 90..962 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RB | 1..1029 | 1..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RB | 1..1029 | 1..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RB | 1..1029 | 1..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13142-RB | 1..1029 | 1..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nse4-RB | 1..1029 | 1..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10439945..10440112 | 399..566 | 100 | -> | Plus |
2L | 10439671..10439888 | 181..398 | 100 | -> | Plus |
2L | 10439440..10439619 | 1..180 | 100 | -> | Plus |
2L | 10440176..10440505 | 567..896 | 100 | -> | Plus |
2L | 10440561..10440693 | 897..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10439945..10440112 | 399..566 | 100 | -> | Plus |
2L | 10439671..10439888 | 181..398 | 100 | -> | Plus |
2L | 10439440..10439619 | 1..180 | 100 | -> | Plus |
2L | 10440176..10440505 | 567..896 | 100 | -> | Plus |
2L | 10440561..10440693 | 897..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10439945..10440112 | 399..566 | 100 | -> | Plus |
2L | 10439671..10439888 | 181..398 | 100 | -> | Plus |
2L | 10439440..10439619 | 1..180 | 100 | -> | Plus |
2L | 10440176..10440505 | 567..896 | 100 | -> | Plus |
2L | 10440561..10440693 | 897..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10439440..10439619 | 1..180 | 100 | -> | Plus |
arm_2L | 10439671..10439888 | 181..398 | 100 | -> | Plus |
arm_2L | 10439945..10440112 | 399..566 | 100 | -> | Plus |
arm_2L | 10440176..10440505 | 567..896 | 100 | -> | Plus |
arm_2L | 10440561..10440693 | 897..1029 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10439671..10439888 | 181..398 | 100 | -> | Plus |
2L | 10439945..10440112 | 399..566 | 100 | -> | Plus |
2L | 10440176..10440505 | 567..896 | 100 | -> | Plus |
2L | 10440561..10440693 | 897..1029 | 100 | Plus | |
2L | 10439440..10439619 | 1..180 | 100 | -> | Plus |
Translation from 89 to 961
> IP09347.hyp MDSSESQSQMDDQDARILRLQNLIEKNIEIEQQIENNTIGESITAIEEII QTANDISKGHEDRRTNSTELVLDTELLRRNFEVVGKAIQHNTNVTDRMVA TAINDLVFKESEEDWDALCSLAIQFGRPLFTNDSMLPFIDVTPKVVVQKQ RAPRKTKSQVDEKRPEKSDQLERKDEGAASVTHMLKQIRQIYRDGNQEPI PYFKLICNPNNFMDTVQNALQLSFLVKENYISIENGEDGLPLVRVVNSKS VEGNAPSQAICSIDVTFCEKMVKHYNLHEPMLKRLPVSEK*
Translation from 89 to 961
> IP09347.pep MDSSESQSQMDDQDARILRLQNLIEKNIEIEQQIENNTIGESITAIEEII QTANDISKGHEDRRTNSTELVLDTELLRRNFEVVGKAIQHNTNVTDRMVA TAINDLVFKESEEDWDALCSLAIQFGRPLFTNDSMLPFIDVTPKVVVQKQ RAPRKTKSQVDEKRPEKSDQLERKDEGAASVTHMLKQIRQIYRDGNQEPI PYFKLICNPNNFMDTVQNALQLSFLVKENYISIENGEDGLPLVRVVNSKS VEGNAPSQAICSIDVTFCEKMVKHYNLHEPMLKRLPVSEK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15793-PA | 291 | GF15793-PA | 16..277 | 12..282 | 1008 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23641-PA | 271 | GG23641-PA | 1..270 | 1..289 | 1180 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13614-PA | 275 | GH13614-PA | 21..274 | 16..289 | 731 | 54.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Nse4-PC | 290 | CG13142-PC | 1..290 | 1..290 | 1477 | 100 | Plus |
Nse4-PB | 290 | CG13142-PB | 1..290 | 1..290 | 1477 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20488-PA | 289 | GI20488-PA | 4..288 | 8..289 | 941 | 61.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19011-PA | 267 | GL19011-PA | 2..262 | 5..285 | 879 | 61 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12076-PA | 267 | GA12076-PA | 2..262 | 5..285 | 875 | 60.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18438-PA | 271 | GM18438-PA | 1..271 | 1..290 | 1289 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23706-PA | 271 | GD23706-PA | 1..271 | 1..290 | 1311 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13829-PA | 275 | GJ13829-PA | 1..269 | 1..284 | 860 | 59.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15254-PA | 290 | GK15254-PA | 1..287 | 1..285 | 936 | 62.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18462-PA | 271 | GE18462-PA | 1..270 | 1..289 | 1242 | 82.1 | Plus |