Clone IP09347 Report

Search the DGRC for IP09347

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:93
Well:47
Vector:pOT2
Associated Gene/TranscriptNse4-RB
Protein status:IP09347.pep: gold
Preliminary Size:810
Sequenced Size:1051

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13142 2008-04-29 Release 5.5 accounting
CG13142 2008-08-15 Release 5.9 accounting
CG13142 2008-12-18 5.12 accounting

Clone Sequence Records

IP09347.complete Sequence

1051 bp (1051 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023592

> IP09347.complete
CAGAAATCATTTTCAAAGAAATTTGTTTATGTGAATTCACAATTGGATTA
ACTTCGCTCTTCTTTGTTTAGTATTTATTTAACAATAATATGGATTCGTC
TGAAAGCCAATCGCAAATGGATGACCAAGATGCTCGCATACTGCGTCTGC
AAAATCTGATCGAAAAGAATATTGAGATAGAGCAACAAATCGAAAACAAC
ACCATCGGAGAGTCTATCACGGCCATAGAGGAAATCATTCAGACAGCCAA
CGATATCAGCAAGGGACATGAAGACCGCCGTACAAACTCCACGGAACTTG
TCCTGGACACGGAGCTACTGCGTCGCAATTTCGAAGTTGTGGGAAAAGCT
ATCCAACATAACACCAACGTCACGGATCGAATGGTGGCCACGGCGATCAA
CGATTTGGTTTTCAAAGAGAGCGAAGAAGATTGGGATGCTCTTTGTTCAT
TGGCTATTCAGTTCGGAAGACCACTCTTCACCAATGATAGCATGCTGCCC
TTCATAGATGTTACTCCAAAGGTGGTGGTTCAAAAGCAACGTGCTCCTCG
CAAAACGAAATCTCAAGTAGATGAGAAGCGTCCAGAAAAGAGTGACCAAT
TGGAACGCAAGGACGAAGGAGCAGCGTCCGTAACCCACATGCTGAAGCAA
ATAAGACAAATATATCGAGATGGCAATCAAGAGCCGATTCCGTACTTTAA
ACTGATTTGCAATCCAAACAATTTTATGGACACCGTTCAGAACGCTTTGC
AACTGTCGTTTCTTGTCAAGGAGAACTATATTTCCATCGAAAATGGCGAG
GATGGTTTGCCATTGGTTCGCGTTGTGAATTCCAAATCGGTCGAAGGAAA
CGCACCGTCCCAGGCTATTTGTTCCATCGATGTTACCTTTTGTGAGAAAA
TGGTAAAGCACTACAACCTACATGAGCCAATGTTAAAAAGACTTCCGGTT
AGTGAGAAATAGATATATCACTTAGTTCATATTAATAGTTTATATTGTTA
TTAATAAAACACATAGAACGTTTAAAGTTAAAAAAAAAAAAAAAAAAAAA
A

IP09347.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13142-RB 1477 CG13142-RB 51..1080 1..1030 5150 100 Plus
CG13142-RC 1477 CG13142-RC 51..1080 1..1030 5150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10439011..10439340 567..896 1650 100 Plus
chr2L 23010047 chr2L 10438504..10438723 179..398 1100 100 Plus
chr2L 23010047 chr2L 10438275..10438454 1..180 885 99.4 Plus
chr2L 23010047 chr2L 10438780..10438950 399..569 855 100 Plus
chr2L 23010047 chr2L 10439394..10439528 895..1029 675 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10440176..10440505 567..896 1650 100 Plus
2L 23513712 2L 10439669..10439888 179..398 1100 100 Plus
2L 23513712 2L 10439440..10439619 1..180 900 100 Plus
2L 23513712 2L 10439945..10440115 399..569 855 100 Plus
2L 23513712 2L 10440559..10440694 895..1030 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10440176..10440505 567..896 1650 100 Plus
2L 23513712 2L 10439669..10439888 179..398 1100 100 Plus
2L 23513712 2L 10439440..10439619 1..180 900 100 Plus
2L 23513712 2L 10439945..10440115 399..569 855 100 Plus
2L 23513712 2L 10440559..10440694 895..1030 680 100 Plus
Blast to na_te.dros performed 2019-03-16 23:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 611..664 98..43 130 75 Minus

IP09347.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:21:00 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10438275..10438454 1..180 99 -> Plus
chr2L 10438506..10438723 181..398 100 -> Plus
chr2L 10438780..10438947 399..566 100 -> Plus
chr2L 10439011..10439340 567..896 100 -> Plus
chr2L 10439396..10439528 897..1029 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:39:14 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RB 1..873 90..962 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:17 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RC 1..873 90..962 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:04 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RB 1..873 90..962 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:49 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RB 1..873 90..962 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:48:37 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
Nse4-RB 1..873 90..962 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:44:51 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RB 1..1029 1..1029 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:17 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RB 1..1029 1..1029 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:04 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RB 1..1029 1..1029 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:49 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
CG13142-RB 1..1029 1..1029 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:48:37 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
Nse4-RB 1..1029 1..1029 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:21:00 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10439945..10440112 399..566 100 -> Plus
2L 10439671..10439888 181..398 100 -> Plus
2L 10439440..10439619 1..180 100 -> Plus
2L 10440176..10440505 567..896 100 -> Plus
2L 10440561..10440693 897..1029 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:21:00 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10439945..10440112 399..566 100 -> Plus
2L 10439671..10439888 181..398 100 -> Plus
2L 10439440..10439619 1..180 100 -> Plus
2L 10440176..10440505 567..896 100 -> Plus
2L 10440561..10440693 897..1029 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:21:00 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10439945..10440112 399..566 100 -> Plus
2L 10439671..10439888 181..398 100 -> Plus
2L 10439440..10439619 1..180 100 -> Plus
2L 10440176..10440505 567..896 100 -> Plus
2L 10440561..10440693 897..1029 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:04 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10439440..10439619 1..180 100 -> Plus
arm_2L 10439671..10439888 181..398 100 -> Plus
arm_2L 10439945..10440112 399..566 100 -> Plus
arm_2L 10440176..10440505 567..896 100 -> Plus
arm_2L 10440561..10440693 897..1029 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:48 Download gff for IP09347.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10439671..10439888 181..398 100 -> Plus
2L 10439945..10440112 399..566 100 -> Plus
2L 10440176..10440505 567..896 100 -> Plus
2L 10440561..10440693 897..1029 100   Plus
2L 10439440..10439619 1..180 100 -> Plus

IP09347.hyp Sequence

Translation from 89 to 961

> IP09347.hyp
MDSSESQSQMDDQDARILRLQNLIEKNIEIEQQIENNTIGESITAIEEII
QTANDISKGHEDRRTNSTELVLDTELLRRNFEVVGKAIQHNTNVTDRMVA
TAINDLVFKESEEDWDALCSLAIQFGRPLFTNDSMLPFIDVTPKVVVQKQ
RAPRKTKSQVDEKRPEKSDQLERKDEGAASVTHMLKQIRQIYRDGNQEPI
PYFKLICNPNNFMDTVQNALQLSFLVKENYISIENGEDGLPLVRVVNSKS
VEGNAPSQAICSIDVTFCEKMVKHYNLHEPMLKRLPVSEK*

IP09347.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Nse4-PC 290 CG13142-PC 1..290 1..290 1477 100 Plus
Nse4-PB 290 CG13142-PB 1..290 1..290 1477 100 Plus

IP09347.pep Sequence

Translation from 89 to 961

> IP09347.pep
MDSSESQSQMDDQDARILRLQNLIEKNIEIEQQIENNTIGESITAIEEII
QTANDISKGHEDRRTNSTELVLDTELLRRNFEVVGKAIQHNTNVTDRMVA
TAINDLVFKESEEDWDALCSLAIQFGRPLFTNDSMLPFIDVTPKVVVQKQ
RAPRKTKSQVDEKRPEKSDQLERKDEGAASVTHMLKQIRQIYRDGNQEPI
PYFKLICNPNNFMDTVQNALQLSFLVKENYISIENGEDGLPLVRVVNSKS
VEGNAPSQAICSIDVTFCEKMVKHYNLHEPMLKRLPVSEK*

IP09347.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15793-PA 291 GF15793-PA 16..277 12..282 1008 71 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23641-PA 271 GG23641-PA 1..270 1..289 1180 79.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13614-PA 275 GH13614-PA 21..274 16..289 731 54.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Nse4-PC 290 CG13142-PC 1..290 1..290 1477 100 Plus
Nse4-PB 290 CG13142-PB 1..290 1..290 1477 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20488-PA 289 GI20488-PA 4..288 8..289 941 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19011-PA 267 GL19011-PA 2..262 5..285 879 61 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12076-PA 267 GA12076-PA 2..262 5..285 875 60.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18438-PA 271 GM18438-PA 1..271 1..290 1289 85.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23706-PA 271 GD23706-PA 1..271 1..290 1311 86.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13829-PA 275 GJ13829-PA 1..269 1..284 860 59.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15254-PA 290 GK15254-PA 1..287 1..285 936 62.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18462-PA 271 GE18462-PA 1..270 1..289 1242 82.1 Plus