Clone IP09356 Report

Search the DGRC for IP09356

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:93
Well:56
Vector:pOT2
Associated Gene/TranscriptCG13408-RA
Protein status:IP09356.pep: gold
Preliminary Size:774
Sequenced Size:1223

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13408 2008-04-29 Release 5.5 accounting
CG13408 2008-08-15 Release 5.9 accounting
CG13408 2008-12-18 5.12 accounting

Clone Sequence Records

IP09356.complete Sequence

1223 bp assembled on 2006-10-19

GenBank Submission: BT029272

> IP09356.complete
GTTCGTTTATACGGCACAACGGAAAAACGGCTCATTTAGTATCCTATCAG
TCGATTTGTGGCAACAAGTGTCCTTCGAGGATGTGTGTGAGAAGCTCACT
GGGCAGTGTGATTTTAATTTACTTTGTCATCTTGCTTCGTTTGGTCAACT
TGGTGCTGGCCCAGAACGAAGGGAATATATCGGAATCGACGGTGGCCACG
GGCCGCGAGGAGTGCGGCAGCACGCAGAAAATGGTGGACGAGTGCTTCAA
GGATCTGCCGCCGCATCTAATGGATTTCCTACAGAACACGAAAATCGTCA
TCAGCAAAAAGGAGATCACCGCCAAGTGCAACATATTCAACCGTGGCATG
AGGTGCTTCGATACTTACTCCAAGCGTTGCCTGGACGATCGAAAGATGGG
CACGTTTAAGAATAATGTGGAGGGAGCTCGGCGATTTTTCTACAAGTTCT
GCGGCGACGCCGATTTTCAGCGTGACTATCTGAGGCACAAGGACTGCTTT
GCATACATCCAACTGGACTGGGTCACCTGCACCACCGAGTTCGAGAACAT
CCTTAGTGAAGAGGTGCACGACGAAAGGCGCAACGCCAGCGAAAAGTTCC
TCGAATTCTGCTGTGCCCGCTACGCGTACGAGAACTGCATCTACAACAGT
GCCCGCTTCAAGTGCTACAAAAACTCGGCGGAGTTTGCCCGCGAGACGGC
CAAAATGCTGTCGGATGAGAAGCACTTTAGGAACTGTGCCGTCCTCCAGA
ACATCTGTGCCCACGACGCCGCCGTGGCATTGGCCCAGTGGCACTGGATG
GCGACGCCGATGATGCTGCTCCTGATGCGGCTGGTGGTGCGGATCTGGGC
GTAAATCGATGTGATGTTGGGGCTGCGGTTGCGGTCCGAGCTTGGGTTTT
CTTAGTTTTCATTGATTTTTTTTTTTTTTTTGTTTTGGTTTTATCCTTTT
TGGATTGTAGTTGTCCCTACGAGAATGCCAAGCATTTGAGCTACCTTTAG
TAGCCCCATCGATATGAAGAAAAATGAAACTTCCTCTCTACGTGTCTGTG
AATTTTCCGGTGTCGTTTTTTTGGGACGAGTTTGCTGGGCGGGCGGGTTA
CTGGGTCGGATAGCGACACTGGTTTTGTGTTTTTCGCTAAGCTAAGTTAA
CTTAAATGCATATTTCAAATAAAGGAATATTCACGTTGTAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

IP09356.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13408-RA 1522 CG13408-RA 149..1338 1..1190 5950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17906628..17907204 613..1189 2735 98.3 Plus
chr3R 27901430 chr3R 17904126..17904456 1..331 1565 98.2 Plus
chr3R 27901430 chr3R 17905546..17905693 327..474 710 98.6 Plus
chr3R 27901430 chr3R 17905993..17906132 474..613 685 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:57:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22082897..22083474 613..1190 2890 100 Plus
3R 32079331 3R 22080382..22080712 1..331 1655 100 Plus
3R 32079331 3R 22081802..22081949 327..474 725 99.3 Plus
3R 32079331 3R 22082248..22082387 474..613 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21823728..21824305 613..1190 2890 100 Plus
3R 31820162 3R 21821213..21821543 1..331 1655 100 Plus
3R 31820162 3R 21822633..21822780 327..474 725 99.3 Plus
3R 31820162 3R 21823079..21823218 474..613 700 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:30:21 has no hits.

IP09356.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:30:59 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17906967..17907204 952..1189 98   Plus
chr3R 17906629..17906907 614..892 98 == Plus
chr3R 17904126..17904456 1..331 98 -> Plus
chr3R 17905551..17905693 332..474 99 -> Plus
chr3R 17905994..17906132 475..613 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:39:23 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..774 81..854 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:30:43 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..774 81..854 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:49:58 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..774 81..854 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:02:27 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..774 81..854 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:00 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..774 81..854 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:02:01 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..774 81..854 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:30:43 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..1189 1..1189 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:49:58 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..1189 1..1189 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:02:28 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..774 81..854 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:00 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13408-RA 1..1189 1..1189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:59 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22080382..22080712 1..331 100 -> Plus
3R 22081807..22081949 332..474 100 -> Plus
3R 22082249..22082387 475..613 100 -> Plus
3R 22082898..22083473 614..1189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:59 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22080382..22080712 1..331 100 -> Plus
3R 22081807..22081949 332..474 100 -> Plus
3R 22082249..22082387 475..613 100 -> Plus
3R 22082898..22083473 614..1189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:59 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22080382..22080712 1..331 100 -> Plus
3R 22081807..22081949 332..474 100 -> Plus
3R 22082249..22082387 475..613 100 -> Plus
3R 22082898..22083473 614..1189 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:49:58 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17906104..17906434 1..331 100 -> Plus
arm_3R 17907529..17907671 332..474 100 -> Plus
arm_3R 17907971..17908109 475..613 100 -> Plus
arm_3R 17908620..17909195 614..1189 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:56:14 Download gff for IP09356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21821213..21821543 1..331 100 -> Plus
3R 21822638..21822780 332..474 100 -> Plus
3R 21823080..21823218 475..613 100 -> Plus
3R 21823729..21824304 614..1189 100   Plus

IP09356.hyp Sequence

Translation from 2 to 853

> IP09356.hyp
SFIRHNGKTAHLVSYQSICGNKCPSRMCVRSSLGSVILIYFVILLRLVNL
VLAQNEGNISESTVATGREECGSTQKMVDECFKDLPPHLMDFLQNTKIVI
SKKEITAKCNIFNRGMRCFDTYSKRCLDDRKMGTFKNNVEGARRFFYKFC
GDADFQRDYLRHKDCFAYIQLDWVTCTTEFENILSEEVHDERRNASEKFL
EFCCARYAYENCIYNSARFKCYKNSAEFARETAKMLSDEKHFRNCAVLQN
ICAHDAAVALAQWHWMATPMMLLLMRLVVRIWA*

IP09356.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13408-PA 257 CG13408-PA 1..257 27..283 1381 100 Plus
CG9896-PA 253 CG9896-PA 23..195 62..231 169 23.7 Plus

IP09356.pep Sequence

Translation from 80 to 853

> IP09356.pep
MCVRSSLGSVILIYFVILLRLVNLVLAQNEGNISESTVATGREECGSTQK
MVDECFKDLPPHLMDFLQNTKIVISKKEITAKCNIFNRGMRCFDTYSKRC
LDDRKMGTFKNNVEGARRFFYKFCGDADFQRDYLRHKDCFAYIQLDWVTC
TTEFENILSEEVHDERRNASEKFLEFCCARYAYENCIYNSARFKCYKNSA
EFARETAKMLSDEKHFRNCAVLQNICAHDAAVALAQWHWMATPMMLLLMR
LVVRIWA*

IP09356.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18067-PA 229 GF18067-PA 1..229 24..257 895 73.4 Plus
Dana\GF11309-PA 250 GF11309-PA 27..192 43..205 164 25.9 Plus
Dana\GF11308-PA 253 GF11308-PA 56..183 76..205 153 23.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11105-PA 263 GG11105-PA 1..263 1..257 1234 92.4 Plus
Dere\GG20078-PA 253 GG20078-PA 23..195 36..205 154 24.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21009-PA 234 GH21009-PA 1..227 24..255 840 65.5 Plus
Dgri\GH20916-PA 203 GH20916-PA 15..150 76..205 159 25.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13408-PA 257 CG13408-PA 1..257 1..257 1381 100 Plus
CG9896-PA 253 CG9896-PA 23..195 36..205 169 23.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10459-PA 250 GI10459-PA 1..239 1..249 832 60.6 Plus
Dmoj\GI10458-PA 150 GI10458-PA 43..126 148..233 202 51.2 Plus
Dmoj\GI18351-PA 297 GI18351-PA 79..244 43..205 170 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23658-PA 251 GL23658-PA 1..249 1..255 993 71.8 Plus
Dper\GL23512-PA 281 GL23512-PA 1..211 1..217 760 66.7 Plus
Dper\GL10164-PA 256 GL10164-PA 25..195 38..205 167 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12264-PB 251 GA12264-PB 1..249 1..255 993 71.8 Plus
Dpse\GA27283-PA 228 GA27283-PA 12..212 38..241 899 78.9 Plus
Dpse\GA22109-PA 256 GA22109-PA 25..249 38..253 172 23.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26399-PA 256 GM26399-PA 1..255 1..256 1337 96.9 Plus
Dsec\GM15593-PA 253 GM15593-PA 23..195 36..205 154 24.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20920-PA 256 GD20920-PA 1..256 1..257 1340 96.9 Plus
Dsim\GD25092-PA 253 GD25092-PA 23..195 36..205 154 24.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23145-PA 234 GJ23145-PA 6..226 29..254 849 67.7 Plus
Dvir\GJ20750-PA 254 GJ20750-PA 36..201 43..205 172 26.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14242-PA 516 GK14242-PA 1..219 1..224 833 69.6 Plus
Dwil\GK19605-PA 247 GK19605-PA 28..193 43..205 160 25.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10267-PA 263 GE10267-PA 1..263 1..257 1229 90.9 Plus
Dyak\GE11616-PA 253 GE11616-PA 31..195 43..205 169 26.7 Plus