Clone IP09396 Report

Search the DGRC for IP09396

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:93
Well:96
Vector:pOT2
Associated Gene/TranscriptCG15125-RA
Protein status:IP09396.pep: gold
Preliminary Size:849
Sequenced Size:915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15125 2008-04-29 Release 5.5 accounting
CG15125 2008-08-15 Release 5.9 accounting
CG15125 2008-12-18 5.12 accounting

Clone Sequence Records

IP09396.complete Sequence

915 bp (915 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023587

> IP09396.complete
TTGTTAACGACATTTTCGTCCATTAATTTGAGTTTGTTGCAGAGCCTGTT
TGTTACCAAATTTGAATAGCTATCCTTTGATAGCTAAGTTTGTACCCTTA
AACGTTTTCTCAATGGAGGGTTTCGAGTATGTGGTCAATCCTCCAGTATG
GCCGAAAGTCGGATTTCTCAGGAAAATCCATCGGGACTCGAGCGGAGACT
TCTGTAGGGACAGCTACACCAAAAATATTCCGTCGGTCGCTCCTAATACG
TATGATGTTCCCAGACCAATGGGATTTAAGTACCCGTCAAAGGCAGGATT
TTCTGCCTTGGCCAACAAGATGCCACGATTACCAATCTTTCGAGAACTGG
GATATCCCCCTATTGGATCCTACGCTACCGATTTTCCAGGAACTCAATAC
TACTTCACTTTCAACAAGCAAACTGTGCGTGAACAAAAATGGTTGACACC
CGGGCCGTCAACCTATACGCACCACCTCAAATATCCGGACTGGGACGTGG
AGACAGCTTTCGGATCCAAGCGCATCATCTGGCCAGCAGTGGCCGTATTT
TGCAGTCCCCAAAACATTGTCAAATGCTCGACATGTGGCGAAAAGCCAGT
GGGTGACTATTTTCACAACTTTAGCAATGACGCGGACATGTGCCGACAAT
GCATGCATGTCGAGATGGCGGCGATCAAGAAGTGCAATCTTCAGGTGACG
GAGCGGTATAGTCGGCAGCAGAAAATCAAGCAATTCGTACCGGCCAGATA
CTGCGGATTCTTCCACGATCACAACCAAACTACGGCCACAATTGAACGGG
ATTCGCGAAAAGTGCTGCGCCAAAAGATACGCGTGGAAAATTACTTGTAT
CGGCTGAATGCAAAGATAGAATAGAGCTAAATACCCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

IP09396.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15125.a 1477 CG15125.a 533..1419 1..887 4435 100 Plus
CG15125-RA 1130 CG15125-RA 186..1072 1..887 4435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15546412..15546845 453..886 2170 100 Plus
chr2R 21145070 chr2R 15546155..15546330 279..454 880 100 Plus
chr2R 21145070 chr2R 15545906..15546067 119..280 810 100 Plus
chr2R 21145070 chr2R 15545003..15545123 1..121 560 97.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19659166..19659600 453..887 2175 100 Plus
2R 25286936 2R 19658909..19659084 279..454 880 100 Plus
2R 25286936 2R 19658660..19658821 119..280 810 100 Plus
2R 25286936 2R 19657758..19657878 1..121 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19660365..19660799 453..887 2175 100 Plus
2R 25260384 2R 19660108..19660283 279..454 880 100 Plus
2R 25260384 2R 19659859..19660020 119..280 810 100 Plus
2R 25260384 2R 19658957..19659077 1..121 605 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:49:17 has no hits.

IP09396.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:49:55 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15545003..15545121 1..119 97 -> Plus
chr2R 15545907..15546067 120..280 100 -> Plus
chr2R 15546157..15546329 281..453 100 -> Plus
chr2R 15546413..15546845 454..886 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:39:25 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..762 113..874 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:03 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..762 113..874 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:28:10 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..762 113..874 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:35 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..762 113..874 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:20 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..762 113..874 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:44:31 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..849 26..874 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:03 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..886 1..886 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:28:10 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 186..1071 1..886 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:35 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 1..849 26..874 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:20 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
CG15125-RA 186..1071 1..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:55 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19657758..19657876 1..119 100 -> Plus
2R 19658661..19658821 120..280 100 -> Plus
2R 19658911..19659083 281..453 100 -> Plus
2R 19659167..19659599 454..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:55 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19657758..19657876 1..119 100 -> Plus
2R 19658661..19658821 120..280 100 -> Plus
2R 19658911..19659083 281..453 100 -> Plus
2R 19659167..19659599 454..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:55 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19657758..19657876 1..119 100 -> Plus
2R 19658661..19658821 120..280 100 -> Plus
2R 19658911..19659083 281..453 100 -> Plus
2R 19659167..19659599 454..886 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:28:10 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15545263..15545381 1..119 100 -> Plus
arm_2R 15546166..15546326 120..280 100 -> Plus
arm_2R 15546416..15546588 281..453 100 -> Plus
arm_2R 15546672..15547104 454..886 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:34 Download gff for IP09396.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19660366..19660798 454..886 100   Plus
2R 19658957..19659075 1..119 100 -> Plus
2R 19659860..19660020 120..280 100 -> Plus
2R 19660110..19660282 281..453 100 -> Plus

IP09396.hyp Sequence

Translation from 112 to 873

> IP09396.hyp
MEGFEYVVNPPVWPKVGFLRKIHRDSSGDFCRDSYTKNIPSVAPNTYDVP
RPMGFKYPSKAGFSALANKMPRLPIFRELGYPPIGSYATDFPGTQYYFTF
NKQTVREQKWLTPGPSTYTHHLKYPDWDVETAFGSKRIIWPAVAVFCSPQ
NIVKCSTCGEKPVGDYFHNFSNDADMCRQCMHVEMAAIKKCNLQVTERYS
RQQKIKQFVPARYCGFFHDHNQTTATIERDSRKVLRQKIRVENYLYRLNA
KIE*

IP09396.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15125-PA 253 CG15125-PA 1..253 1..253 1398 100 Plus
CG15125-PB 282 CG15125-PB 32..282 3..253 1388 100 Plus

IP09396.pep Sequence

Translation from 112 to 873

> IP09396.pep
MEGFEYVVNPPVWPKVGFLRKIHRDSSGDFCRDSYTKNIPSVAPNTYDVP
RPMGFKYPSKAGFSALANKMPRLPIFRELGYPPIGSYATDFPGTQYYFTF
NKQTVREQKWLTPGPSTYTHHLKYPDWDVETAFGSKRIIWPAVAVFCSPQ
NIVKCSTCGEKPVGDYFHNFSNDADMCRQCMHVEMAAIKKCNLQVTERYS
RQQKIKQFVPARYCGFFHDHNQTTATIERDSRKVLRQKIRVENYLYRLNA
KIE*

IP09396.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11730-PA 286 GF11730-PA 32..285 3..253 1028 75.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21990-PA 253 GG21990-PA 1..253 1..253 1271 90.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23011-PA 289 GH23011-PA 32..289 3..253 797 58.9 Plus
Dgri\GH10055-PA 197 GH10055-PA 1..197 57..253 692 65 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15125-PA 253 CG15125-PA 1..253 1..253 1398 100 Plus
CG15125-PB 282 CG15125-PB 32..282 3..253 1388 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21078-PA 260 GI21078-PA 1..259 1..252 763 56.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10354-PA 327 GL10354-PA 76..325 3..251 761 59.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13513-PA 327 GA13513-PA 76..325 3..251 759 59.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21977-PA 253 GM21977-PA 1..253 1..253 1367 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11473-PA 253 GD11473-PA 1..253 1..253 1354 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20924-PA 289 GJ20924-PA 32..289 3..253 695 57.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15883-PA 604 GK15883-PA 344..604 1..253 752 55.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12070-PA 253 GE12070-PA 1..253 1..253 1298 92.9 Plus