Clone IP09407 Report

Search the DGRC for IP09407

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:94
Well:7
Vector:pOT2
Associated Gene/TranscriptCG10317-RC
Protein status:IP09407.pep: gold
Preliminary Size:811
Sequenced Size:846

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10317 2008-04-29 Release 5.5 accounting
CG10317 2008-08-15 Release 5.9 accounting
CG10317 2008-12-18 5.12 accounting

Clone Sequence Records

IP09407.complete Sequence

846 bp (846 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023585

> IP09407.complete
GTTATCAGAACTTTTCGAACAACTGAAAAATCGGAAGTCTTGAACTCAAC
TAGAAACTTTCGACGCAGTTGTAGTAATTACTTTTGTTTAGGGAGAGCTA
GAAACTTTCAAGCACCAACACCATGAACACCAACACCATCAACCCTCAGG
ACGACTGTAGTAACATCTCCAACAAGGATGTAGAGATCGATCGGGACCAG
GAGCTCCAGACATCATCCGAAATCCAGACACCGGAAACACCGCAGACAGG
GCGGCGCAAAAGGATGGACACGCCCATTCGAGTACGTGACATGATCAACC
TTTACAACTTTGCCACTCAAAAGAACCAGGAACTGGAGATGGCCAAGTCC
CTTTACTTTGGCGCCATGTCAGAGGAAAACCAGAGGACGGATCTTGAGGG
CGGTAGTAGCCTTTGCAACATGTCCATGTCGGACGACAAGGAAAAAGAAA
ATGAGAGTATCCTCCGAGTGAACAAGGAGTCTGCAGTCTTCCAATCGGCC
AATACTGAGCTTCCGTCTGATCCGAATACAGTAGAAAGGTCCTATCAAAG
CAAAACTACAATTCGACACACTAATAAAGGCGTGCGTATAATCATCGACA
TATTTTTTGATAAAAAAGATAGCGAGATAGACATAGTGGGCAGCCGCGTG
GAGACGGACATCCCCGAGAGCCGCATCCTGTCCGATTTCCAGCAGCATTC
GCTGGACATGAAGAACCAGGAGCTAAAGCCGGGGATCCAGGATGGATCGA
GTACCCCCAAGTCCGCGTAGGCTAGTCCCAGGTATCCAGGAGATAACTAA
CTAAATTCCAGTACAAAACAAACCAAAAAAAAAAAAAAAAAAAAAA

IP09407.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG10317.d 1542 CG10317.d 192..1024 1..833 4165 100 Plus
CG10317.b 1363 CG10317.b 192..1024 1..833 4165 100 Plus
CG10317-RD 1262 CG10317-RD 192..1024 1..833 4165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12194668..12195118 451..1 2255 100 Minus
chr3R 27901430 chr3R 12194110..12194345 811..576 1180 100 Minus
chr3R 27901430 chr3R 12194481..12194609 580..452 615 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16370003..16370453 451..1 2255 100 Minus
3R 32079331 3R 16369445..16369680 811..576 1180 100 Minus
3R 32079331 3R 16369816..16369944 580..452 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16110834..16111284 451..1 2255 100 Minus
3R 31820162 3R 16110276..16110511 811..576 1180 100 Minus
3R 31820162 3R 16110647..16110775 580..452 645 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:35:37 has no hits.

IP09407.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:36:42 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12194110..12194341 580..811 100 <- Minus
chr3R 12194482..12194609 452..579 98 <- Minus
chr3R 12194668..12195118 1..451 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:45 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RD 1..648 123..770 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:44:03 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RC 1..648 123..770 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:20:07 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RB 1..463 123..586 99 == Plus
CG10317-RB 464..609 625..770 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:55 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RC 1..648 123..770 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:47:50 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RA 81..665 1..586 99 == Plus
CG10317-RA 666..852 625..811 100 -> Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:45 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RD 81..904 1..824 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:44:03 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RC 81..891 1..811 100 -> Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:20:07 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RA 81..665 1..586 99 == Plus
CG10317-RA 666..852 625..811 100 -> Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:55 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
CG10317-RC 81..891 1..811 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:42 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16370003..16370453 1..451 100   Minus
3R 16369445..16369676 580..811 100 <- Minus
3R 16369817..16369944 452..579 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:42 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16370003..16370453 1..451 100   Minus
3R 16369445..16369676 580..811 100 <- Minus
3R 16369817..16369944 452..579 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:42 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16370003..16370453 1..451 100   Minus
3R 16369445..16369676 580..811 100 <- Minus
3R 16369817..16369944 452..579 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:44:03 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12195539..12195666 452..579 100 <- Minus
arm_3R 12195167..12195398 580..811 100 <- Minus
arm_3R 12195725..12196175 1..451 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:55:06 Download gff for IP09407.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16110276..16110507 580..811 100 <- Minus
3R 16110648..16110775 452..579 100 <- Minus
3R 16110834..16111284 1..451 100   Minus

IP09407.hyp Sequence

Translation from 122 to 769

> IP09407.hyp
MNTNTINPQDDCSNISNKDVEIDRDQELQTSSEIQTPETPQTGRRKRMDT
PIRVRDMINLYNFATQKNQELEMAKSLYFGAMSEENQRTDLEGGSSLCNM
SMSDDKEKENESILRVNKESAVFQSANTELPSDPNTVERSYQSKTTIRHT
NKGVRIIIDIFFDKKDSEIDIVGSRVETDIPESRILSDFQQHSLDMKNQE
LKPGIQDGSSTPKSA*

IP09407.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG10317-PD 215 CG10317-PD 1..215 1..215 1096 100 Plus
CG10317-PC 215 CG10317-PC 1..215 1..215 1096 100 Plus

IP09407.pep Sequence

Translation from 122 to 769

> IP09407.pep
MNTNTINPQDDCSNISNKDVEIDRDQELQTSSEIQTPETPQTGRRKRMDT
PIRVRDMINLYNFATQKNQELEMAKSLYFGAMSEENQRTDLEGGSSLCNM
SMSDDKEKENESILRVNKESAVFQSANTELPSDPNTVERSYQSKTTIRHT
NKGVRIIIDIFFDKKDSEIDIVGSRVETDIPESRILSDFQQHSLDMKNQE
LKPGIQDGSSTPKSA*

IP09407.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16519-PA 189 GF16519-PA 9..189 12..200 443 53.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20004-PA 219 GG20004-PA 1..218 1..214 907 81.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18249-PA 183 GH18249-PA 28..174 49..193 357 53 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG10317-PD 215 CG10317-PD 1..215 1..215 1096 100 Plus
CG10317-PC 215 CG10317-PC 1..215 1..215 1096 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23648-PA 239 GI23648-PA 47..234 47..202 384 49.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22244-PA 202 GL22244-PA 26..197 51..203 266 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10240-PA 202 GA10240-PA 26..197 51..203 263 37 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15437-PA 215 GM15437-PA 1..215 1..215 1040 91.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20293-PA 154 GD20293-PA 1..153 1..153 733 90.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23492-PA 221 GJ23492-PA 26..216 32..202 417 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13505-PA 274 GK13505-PA 72..254 51..196 390 50.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26317-PA 220 GE26317-PA 1..219 1..214 923 82.6 Plus