Clone IP09417 Report

Search the DGRC for IP09417

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:94
Well:17
Vector:pOT2
Associated Gene/TranscriptCG11192-RB
Protein status:IP09417.pep: validated full length
Preliminary Size:810
Sequenced Size:962

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11192 2005-01-01 Successful iPCR screen
CG11192 2008-04-29 Release 5.5 accounting
CG11192 2008-08-15 Release 5.9 accounting
CG11192 2008-12-18 5.12 accounting

Clone Sequence Records

IP09417.complete Sequence

962 bp (962 high quality bases) assembled on 2005-01-27

GenBank Submission: BT023166

> IP09417.complete
ACTCAACGAAATTTTTATGGTGGCTAATGGCACTCGTGGCATATGCCGGA
GCCACGCCCACTCCCGGCGATGGGCGGATTGTGGGTGGCGAGGTGGCCAC
CATTCAAGAATTTCCCTATCAAGTATCCGTCCAGTTGCAAGGCCGGCACA
TATGCGGTGGAGCCATCATTGGCATCGACACCGTACTGACAGCGGCCCAT
TGCTTCGAGGATCCCTGGAGCAGTGCAGATTACACAGTGCGAGTGGGTTC
CAGCGAGCATGAGAGTGGGGGCCATGTGCTCAGCCTGCGGCGAGTCATCG
CCCACGGCGATTATAATCCCCAGAGCCACGACAACGACCTGGCGTTGCTC
ATCTTGAATGGCCAGCTCAATTTCACCGAGCACCTGCAGCCAGTGCCACT
GGCCGCATTAGCGGACCCACCCACCGCGGACACCCGTCTCCAGGTCAGCG
GTTGGGGTTTCCAGGCCGAGGAGAGTGCAGTCAGCGGTGAAGTTGGAGTG
TCTCCGCAACTTCGTTTCGTGGACGTGGATCTGGTGGAGTCGAATCAGTG
CCGGCGTGCCTATAGCCAGGTGTTGCCCATAACCCGGCGGATGATCTGTG
CCGCGCGTCCAGGTCGGGATAGTTGCCAGGGCGACTCTGGCGGACCACTG
GTGGGTTACGCAGCGGAAGAAGGTCCGGCCAGGCTATATGGCATCGTTTC
CTGGGGCCTGGGCTGCGCAAATCCCAACTTTCCAGGAGTGTACACCAATG
TGGCTGCCTTCCGCAGCTGGATAGATGAGCAGTTGGACGCCAGGGGATGG
GATGAACTGCTGGCGGGCTGGAGTAGATTGCAATAATGTGCAGAAAAATG
TAAAACCTAGTAGATAATAGTATTAAGTGTTATACAAATATTTGTTTTAA
AATAAAATAAAATGTATTTAAATAAAAAAAAGCTGTTTAATTAAAAAAAA
AAAAAAAAAAAA

IP09417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG11192-RB 949 CG11192-RB 5..949 1..945 4725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16241144..16242071 931..1 4470 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20354105..20355049 945..1 4725 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20355304..20356248 945..1 4725 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:34:39 has no hits.

IP09417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:35:42 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16241190..16242071 1..885 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:39:36 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..840 1..836 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:46 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..840 1..836 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:52:23 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..840 1..836 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:56:24 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..840 1..836 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:57:22 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..840 1..836 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:06:04 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..946 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:46 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..946 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:52:23 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 19..960 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:56:24 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 5..946 1..942 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:57:22 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
CG11192-RB 19..960 1..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:35:42 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20354108..20355049 1..942 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:35:42 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20354108..20355049 1..942 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:35:42 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20354108..20355049 1..942 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:52:23 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16241613..16242554 1..942 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:39 Download gff for IP09417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20355307..20356248 1..942 100   Minus

IP09417.hyp Sequence

Translation from 2 to 835

> IP09417.hyp
STKFLWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHI
CGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIA
HGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSG
WGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICA
ARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNV
AAFRSWIDEQLDARGWDELLAGWSRLQ*

IP09417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG11192-PB 279 CG11192-PB 3..279 1..277 1479 100 Plus
CG13430-PB 267 CG13430-PB 13..264 7..262 496 41.3 Plus
CG13430-PA 267 CG13430-PA 13..264 7..262 496 41.3 Plus
gammaTry-PA 253 CG30028-PA 3..249 3..257 470 40.6 Plus
deltaTry-PA 253 CG12351-PA 3..249 3..257 470 40.6 Plus

IP09417.pep Sequence

Translation from 26 to 835

> IP09417.pep
MALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGI
DTVLTAAHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQS
HDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEES
AVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARPGRDSC
QGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWID
EQLDARGWDELLAGWSRLQ*

IP09417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12668-PA 287 GF12668-PA 19..287 9..269 1019 73.2 Plus
Dana\GF12662-PA 267 GF12662-PA 29..264 15..254 473 42.8 Plus
Dana\GF12545-PA 273 GF12545-PA 34..261 15..253 467 40.6 Plus
Dana\GF15291-PA 246 GF15291-PA 24..245 17..255 464 44.2 Plus
Dana\GF13692-PA 261 GF13692-PA 17..254 6..249 461 41.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20864-PA 269 GG20864-PA 1..269 1..269 1250 88.5 Plus
Dere\GG20853-PA 267 GG20853-PA 29..264 15..254 484 42.8 Plus
Dere\GG20381-PA 259 GG20381-PA 32..252 16..249 429 38.7 Plus
Dere\GG20193-PA 273 GG20193-PA 34..261 15..253 429 40.6 Plus
Dere\GG24539-PA 247 GG24539-PA 23..240 17..249 425 43 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20835-PA 278 GH20835-PA 18..275 7..269 809 63.5 Plus
Dgri\GH21062-PA 276 GH21062-PA 27..265 9..249 483 41.1 Plus
Dgri\GH22928-PA 243 GH22928-PA 2..236 9..249 469 43.7 Plus
Dgri\GH22926-PA 256 GH22926-PA 28..255 15..255 456 40.5 Plus
Dgri\GH22923-PA 266 GH22923-PA 22..257 7..256 446 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG11192-PB 279 CG11192-PB 11..279 1..269 1429 100 Plus
CG13430-PB 267 CG13430-PB 19..264 5..254 483 41.5 Plus
CG13430-PA 267 CG13430-PA 19..264 5..254 483 41.5 Plus
gammaTry-PA 253 CG30028-PA 28..249 15..249 461 41.9 Plus
CG30025-PA 253 CG30025-PA 28..249 15..249 461 41.9 Plus
deltaTry-PA 253 CG12351-PA 28..249 15..249 461 41.9 Plus
CG30031-PA 253 CG30031-PA 28..249 15..249 461 41.9 Plus
alphaTry-PA 256 CG18444-PA 10..249 2..249 461 40.9 Plus
betaTry-PB 253 CG18211-PB 28..249 15..249 459 42.4 Plus
betaTry-PA 253 CG18211-PA 28..249 15..249 459 42.4 Plus
CG17239-PB 248 CG17239-PB 23..237 17..249 425 42.5 Plus
CG17239-PA 248 CG17239-PA 23..237 17..249 425 42.5 Plus
epsilonTry-PA 256 CG18681-PA 28..250 15..250 421 39.7 Plus
Ser8-PA 260 CG4812-PA 33..253 16..249 419 38.3 Plus
Try29F-PD 267 CG9564-PD 39..261 15..249 416 44.2 Plus
Try29F-PC 267 CG9564-PC 39..261 15..249 416 44.2 Plus
lambdaTry-PA 272 CG12350-PA 33..258 15..251 410 38.4 Plus
CG17571-PB 258 CG17571-PB 9..257 1..255 406 39.5 Plus
CG17571-PA 258 CG17571-PA 9..257 1..255 406 39.5 Plus
CG32376-PA 291 CG32376-PA 65..284 17..249 400 38.7 Plus
CG31954-PA 277 CG31954-PA 48..273 15..251 399 41.2 Plus
CG31681-PA 264 CG31681-PA 10..249 3..249 393 41.3 Plus
CG8299-PA 260 CG8299-PA 28..258 18..255 390 38.1 Plus
Ser12-PA 245 CG17240-PA 17..238 7..249 389 39.9 Plus
CG34458-PA 257 CG34458-PA 29..253 15..251 378 37.3 Plus
thetaTry-PA 262 CG12385-PA 21..255 4..249 378 39 Plus
zetaTry-PA 280 CG12387-PA 36..277 15..253 370 38 Plus
etaTry-PA 262 CG12386-PA 19..257 9..252 366 36.6 Plus
CG16998-PA 258 CG16998-PA 24..247 17..254 359 38.6 Plus
CG7829-PA 253 CG7829-PA 25..250 15..254 353 35.1 Plus
CG10405-PB 268 CG10405-PB 28..262 9..249 353 35.8 Plus
iotaTry-PA 252 CG7754-PA 11..251 1..255 348 32.6 Plus
CG33159-PA 257 CG33159-PA 13..243 1..246 343 38.3 Plus
CG11836-PI 281 CG11836-PI 44..275 17..254 339 33.6 Plus
CG11836-PJ 333 CG11836-PJ 96..327 17..254 339 33.6 Plus
CG18735-PA 364 CG18735-PA 82..313 17..251 339 34.4 Plus
CG32755-PA 315 CG32755-PA 37..271 17..249 338 35.7 Plus
CG32269-PB 332 CG32269-PB 100..324 9..248 338 36.1 Plus
CG32269-PA 332 CG32269-PA 100..324 9..248 338 36.1 Plus
l(2)k05911-PC 639 CG31728-PC 394..634 12..249 337 34.4 Plus
CG4914-PA 374 CG4914-PA 125..362 15..251 333 34.4 Plus
Send1-PA 255 CG17012-PA 29..244 17..254 331 35 Plus
CG9294-PB 352 CG9294-PB 100..334 17..249 330 36.8 Plus
CG32374-PA 299 CG32374-PA 73..292 17..249 329 35.3 Plus
CG32271-PA 248 CG32271-PA 10..246 3..253 321 35.2 Plus
kappaTry-PC 263 CG12388-PC 23..261 15..257 319 33.2 Plus
CG8172-PE 545 CG8172-PE 282..538 7..251 317 34.3 Plus
CG9676-PA 251 CG9676-PA 27..248 17..252 311 35 Plus
CG14780-PA 302 CG14780-PA 32..271 17..250 311 37.2 Plus
CG17234-PA 251 CG17234-PA 26..243 17..249 309 34.7 Plus
Send2-PA 239 CG18125-PA 26..230 17..254 308 34.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20937-PA 283 GI20937-PA 23..278 9..269 807 64.4 Plus
Dmoj\GI18664-PA 278 GI18664-PA 33..270 10..249 463 42.4 Plus
Dmoj\GI18354-PA 254 GI18354-PA 28..248 17..249 440 40.4 Plus
Dmoj\GI18352-PA 287 GI18352-PA 45..279 3..249 431 38.6 Plus
Dmoj\GI17455-PA 260 GI17455-PA 32..254 15..249 429 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16818-PA 287 GL16818-PA 25..287 11..269 921 70.9 Plus
Dper\GL16806-PA 265 GL16806-PA 27..261 15..253 491 43.8 Plus
Dper\GL17142-PA 256 GL17142-PA 28..249 15..249 432 40.7 Plus
Dper\GL17339-PA 256 GL17339-PA 28..249 15..249 429 39.8 Plus
Dper\GL17140-PA 237 GL17140-PA 9..227 23..255 416 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10829-PA 287 GA10829-PA 25..287 9..269 922 71.1 Plus
Dpse\GA17236-PA 265 GA17236-PA 27..261 15..253 491 43.8 Plus
Dpse\GA11574-PA 269 GA11574-PA 30..259 11..255 453 39.7 Plus
Dpse\GA24979-PA 256 GA24979-PA 28..249 15..249 434 40.7 Plus
Dpse\GA14937-PA 256 GA14937-PA 28..249 15..249 429 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19789-PA 279 GM19789-PA 11..279 1..269 1319 93.3 Plus
Dsec\GM19780-PA 267 GM19780-PA 29..264 15..254 478 42.4 Plus
Dsec\GM17347-PA 258 GM17347-PA 30..252 15..249 416 44.6 Plus
Dsec\GM21281-PA 272 GM21281-PA 33..260 15..253 411 39.3 Plus
Dsec\GM21468-PA 260 GM21468-PA 34..253 17..249 409 37.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25281-PA 279 GD25281-PA 11..279 1..269 1340 95.2 Plus
Dsim\GD25272-PA 267 GD25272-PA 29..264 15..254 482 42.8 Plus
Dsim\GD15391-PA 253 GD15391-PA 28..249 15..249 434 40.7 Plus
Dsim\GD15412-PA 260 GD15412-PA 34..253 17..249 415 38 Plus
Dsim\GD13048-PA 367 GD13048-PA 141..362 17..251 414 37.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20662-PA 275 GJ20662-PA 11..274 3..269 901 64.9 Plus
Dvir\GJ21680-PA 278 GJ21680-PA 33..276 10..255 464 41 Plus
Dvir\GJ21494-PA 265 GJ21494-PA 15..249 1..249 440 40.5 Plus
Dvir\GJ21497-PA 309 GJ21497-PA 81..302 15..249 431 41.5 Plus
Dvir\GJ20754-PA 253 GJ20754-PA 23..248 17..254 416 38.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15979-PA 277 GK15979-PA 19..273 9..269 827 66 Plus
Dwil\GK20985-PA 268 GK20985-PA 30..265 15..254 500 42.8 Plus
Dwil\GK20989-PA 268 GK20989-PA 30..265 15..254 493 42.4 Plus
Dwil\GK19007-PA 261 GK19007-PA 33..254 15..249 463 43.2 Plus
Dwil\GK19691-PA 259 GK19691-PA 18..248 9..254 445 41 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13804-PA 269 GE13804-PA 1..269 1..269 1301 91.8 Plus
Dyak\GE13793-PA 267 GE13793-PA 29..264 15..254 479 42.8 Plus
Dyak\GE12353-PA 253 GE12353-PA 28..249 15..249 436 41.5 Plus
Dyak\GE12542-PA 259 GE12542-PA 32..252 16..249 428 38.7 Plus
Dyak\GE13533-PA 256 GE13533-PA 28..249 15..249 427 40.3 Plus