Clone IP09464 Report

Search the DGRC for IP09464

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:94
Well:64
Vector:pOT2
Associated Gene/TranscriptCG13747-RA
Protein status:IP09464.pep: gold
Preliminary Size:781
Sequenced Size:927

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13747 2008-04-29 Release 5.5 accounting
CG13747 2008-08-15 Release 5.9 accounting
CG13747 2008-12-18 5.12 accounting

Clone Sequence Records

IP09464.complete Sequence

927 bp (927 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023577

> IP09464.complete
TTGCAAACACAAACAGACCCCAAACAGCAGATTCCGGCAGAAAGCACGTT
CAGTTGGAAAACAACAAACGGTAACATGGCCCCCAACGATCCATCGCATC
CTGGTGGAAAGTCAACCGCCGTGGCGATGGCCACCAGCCACACCATCTCA
TACGTGCAATGCCAGAACCTCAAATACAACGTCATTATCCTCGGCTGGCT
GGGCGTGATCATCTCCACCGTCATCTTGGGCAGCTCGGCGCTGACCATCC
ACTTTCGTCCGGACATCGAGCTGCTGCTAAACCAGTGGCCCATGAACTTG
GTCCCGGTCGCAGAACAGCAGCTACTGATCAATTTGTTGACCATCTTTAG
CTCCATTGTGTACGGACTGTCGCTGATCAACATGGGCGTCAGTCTGCTGC
TGCTGATTGGTATTGCCCGGGACTCAAGCTGCCTAATTTATCCTTGGCTG
ATCTATCATGGCGTTATTTTTGGCTTTGGTCTTTACTTGGGGGTTTTCTA
CGCGACCGCAGGTCTGTTCATTGACCTGTCGAGCTTTCTAATGTGTCTTC
TGGTGTTCAACCTTGTGCTGGTTATATTTTATAAGATCTATCACGAGGTC
TTCACCCTATTTCGCGTGATGGAGCAGCTGTCGAAGGATGGCGGAATGGG
CGGACTCTACTACCAGGATGCGGAGCATGGATGGACTGCGGCTGGGGTTC
CCTTTCAACATGTCTATGTGCCGCGTCTGCCGATGCAAAAGTAACATGCA
CATTAACCATTTCCAGACCCAGACTGCAACACCAACAGCAACGAATTCAA
AAAATTAGAAAAATATATCATTTGGACTTTGCTTGTACTATTAATAAAAC
TATAATACTATTACTAAAAAAGTACTATAAATAAACAACTCGAATTCATT
TCAAAAAAAAAAAAAAAAAAAAAAAAA

IP09464.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13747-RA 1026 CG13747-RA 123..1026 1..904 4520 100 Plus
CG13747.a 927 CG13747.a 38..608 1..571 2855 100 Plus
CG13747.a 927 CG13747.a 608..927 585..904 1600 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4906256..4906587 571..902 1660 100 Plus
chr2R 21145070 chr2R 4905447..4905780 1..334 1655 99.7 Plus
chr2R 21145070 chr2R 4906052..4906203 420..571 760 100 Plus
chr2R 21145070 chr2R 4905845..4905931 335..421 435 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9017892..9018225 1..334 1670 100 Plus
2R 25286936 2R 9018701..9019034 571..904 1670 100 Plus
2R 25286936 2R 9018497..9018648 420..571 760 100 Plus
2R 25286936 2R 9018290..9018376 335..421 435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9019900..9020233 571..904 1670 100 Plus
2R 25260384 2R 9019091..9019424 1..334 1670 100 Plus
2R 25260384 2R 9019696..9019847 420..571 760 100 Plus
2R 25260384 2R 9019489..9019575 335..421 435 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:42:49 has no hits.

IP09464.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:43:54 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4905447..4905780 1..334 99 -> Plus
chr2R 4905845..4905930 335..420 100 -> Plus
chr2R 4906053..4906203 421..571 100 -> Plus
chr2R 4906257..4906587 572..902 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:40:03 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 1..669 76..744 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:57 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 1..669 76..744 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:58 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 1..669 76..744 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:29 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 1..669 76..744 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:18 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 1..669 76..744 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:44:15 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 38..939 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:57 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 38..939 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:58 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 78..979 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:29 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 38..939 1..902 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:18 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
CG13747-RA 78..979 1..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:54 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9017892..9018225 1..334 100 -> Plus
2R 9018290..9018375 335..420 100 -> Plus
2R 9018498..9018648 421..571 100 -> Plus
2R 9018702..9019032 572..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:54 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9017892..9018225 1..334 100 -> Plus
2R 9018290..9018375 335..420 100 -> Plus
2R 9018498..9018648 421..571 100 -> Plus
2R 9018702..9019032 572..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:54 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9017892..9018225 1..334 100 -> Plus
2R 9018290..9018375 335..420 100 -> Plus
2R 9018498..9018648 421..571 100 -> Plus
2R 9018702..9019032 572..902 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:58 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4905397..4905730 1..334 100 -> Plus
arm_2R 4905795..4905880 335..420 100 -> Plus
arm_2R 4906003..4906153 421..571 100 -> Plus
arm_2R 4906207..4906537 572..902 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:27 Download gff for IP09464.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9019091..9019424 1..334 100 -> Plus
2R 9019489..9019574 335..420 100 -> Plus
2R 9019697..9019847 421..571 100 -> Plus
2R 9019901..9020231 572..902 100   Plus

IP09464.hyp Sequence

Translation from 0 to 743

> IP09464.hyp
LQTQTDPKQQIPAESTFSWKTTNGNMAPNDPSHPGGKSTAVAMATSHTIS
YVQCQNLKYNVIILGWLGVIISTVILGSSALTIHFRPDIELLLNQWPMNL
VPVAEQQLLINLLTIFSSIVYGLSLINMGVSLLLLIGIARDSSCLIYPWL
IYHGVIFGFGLYLGVFYATAGLFIDLSSFLMCLLVFNLVLVIFYKIYHEV
FTLFRVMEQLSKDGGMGGLYYQDAEHGWTAAGVPFQHVYVPRLPMQK*

IP09464.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13747-PA 222 CG13747-PA 1..222 26..247 1155 100 Plus
CG15098-PA 186 CG15098-PA 2..160 49..208 156 26.4 Plus

IP09464.pep Sequence

Translation from 0 to 743

> IP09464.pep
LQTQTDPKQQIPAESTFSWKTTNGNMAPNDPSHPGGKSTAVAMATSHTIS
YVQCQNLKYNVIILGWLGVIISTVILGSSALTIHFRPDIELLLNQWPMNL
VPVAEQQLLINLLTIFSSIVYGLSLINMGVSLLLLIGIARDSSCLIYPWL
IYHGVIFGFGLYLGVFYATAGLFIDLSSFLMCLLVFNLVLVIFYKIYHEV
FTLFRVMEQLSKDGGMGGLYYQDAEHGWTAAGVPFQHVYVPRLPMQK*

IP09464.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12223-PA 222 GF12223-PA 1..222 26..247 911 79.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23403-PA 221 GG23403-PA 1..221 26..247 1076 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12942-PA 213 GH12942-PA 4..213 32..247 629 56.9 Plus
Dgri\GH21633-PA 213 GH21633-PA 4..213 32..247 623 56.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13747-PA 222 CG13747-PA 1..222 26..247 1155 100 Plus
CG15098-PA 186 CG15098-PA 2..160 49..208 156 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20088-PA 217 GI20088-PA 3..216 29..246 597 57.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17611-PA 217 GL17611-PA 1..217 26..247 756 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12504-PA 217 GA12504-PA 1..217 26..247 756 68.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21085-PA 222 GM21085-PA 1..222 26..247 1135 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10621-PA 222 GD10621-PA 1..222 26..247 1131 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21178-PA 217 GJ21178-PA 1..217 26..247 671 60.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17991-PA 244 GK17991-PA 48..227 49..226 669 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19245-PA 222 GE19245-PA 1..222 26..247 1087 93.2 Plus