Clone IP09472 Report

Search the DGRC for IP09472

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:94
Well:72
Vector:pOT2
Associated Gene/TranscriptCG14258-RA
Protein status:IP09472.pep: gold
Preliminary Size:777
Sequenced Size:952

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14258 2008-04-29 Release 5.5 accounting
CG14258 2008-08-15 Release 5.9 accounting
CG14258 2008-12-18 5.12 accounting

Clone Sequence Records

IP09472.complete Sequence

952 bp (952 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023578

> IP09472.complete
GTTCTAGTCATCACATTTTGGAATAAAATTATCAAGATGCTTATTAAAGT
TGCCAAGTTCCTGAGTATTGTAGCCGTACTCCTTTCAGCAGTCGAAGGAG
CTAAATATCTGGCAGAGAAACCCGACTTCCTAATCCCATGTATCGTGGGC
GATCCCAACTTTAATGTCTGTCTGACCAAAAACTTCCAGAGTTTCTTCCG
TCAGTGGAAGGACGGAATTCCCGGCTACAATGCCGTGGGATCCTTTGATC
CTTTTTACATCAAGAGAGTGAAATTTACCCAGGATGCCAGCAGGTCTATA
GCTATCAATGCCGATCTGAAGGAAGTCTATGTAGCAGGTGCTGGTCAAGC
ATTAGTCTTGGAATCCAGCTGGGATCCAAATCACTATGTAGCCAGGACTT
TGATTTCCGTGCCCAAGTTGCGTTTCAATTTCGATTACAAAGTCAAAGGA
CACGTCTCAGCGCTGAATCTCAATGGTCATGGCAAGGGATACTTCGAAGC
TGAAAATGCTCTGTTATTGTTGGAATTGGCTGTCAAACCGCTGGCCACCT
CAGATGGTTATTTCGCTGATGTGCAAAGTGTAAAGGTAAATTTCCGCGAG
ATCAAGCAATTCCGCATCAAGCTGGAAAATCTCTTTGGCGGCAACAAGGA
TCTGGAGGATACTGCACACATTTTGTTCAACGAAAACTGGCGCGACTTCT
TTGAGGTACTGCGTCCGGCGGTGGAGCAAACAGTTGGCGGAGTGCTTTTG
GATCGGTTCAAGAAGACCTTTGTCTATGTACCAGCTACCTATTTGATTAA
AGACTTTCACTAAATGCTAAATTAGCATATAATCCGGTACTTCTATGTTA
TTTTAATGGGTTCGTGTGCTCTGTCGTTTTGTATTAAATGGGTAGTAGTG
TAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

IP09472.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14258-RA 990 CG14258-RA 70..971 1..902 4510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22916852..22917247 502..897 1950 99.5 Plus
chr3R 27901430 chr3R 22916362..22916608 122..368 1190 98.8 Plus
chr3R 27901430 chr3R 22916660..22916796 366..502 670 99.3 Plus
chr3R 27901430 chr3R 22916170..22916290 1..121 590 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27093825..27094225 502..902 2005 100 Plus
3R 32079331 3R 27093335..27093581 122..368 1235 100 Plus
3R 32079331 3R 27093633..27093769 366..502 685 100 Plus
3R 32079331 3R 27093143..27093263 1..121 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26834656..26835056 502..902 2005 100 Plus
3R 31820162 3R 26834166..26834412 122..368 1235 100 Plus
3R 31820162 3R 26834464..26834600 366..502 685 100 Plus
3R 31820162 3R 26833974..26834094 1..121 605 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:29:49 has no hits.

IP09472.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:30:56 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22916170..22916290 1..121 99 -> Plus
chr3R 22916362..22916608 122..368 98 -> Plus
chr3R 22916663..22916796 369..502 99 -> Plus
chr3R 22916853..22917251 503..901 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:40:09 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..777 37..813 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:58 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..777 37..813 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:38 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..777 37..813 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:30 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..777 37..813 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:42:03 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..777 37..813 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:44:18 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..777 37..813 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:58 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..901 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:38 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..901 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:30 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..777 37..813 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:42:03 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
CG14258-RA 1..901 1..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:30:56 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27093143..27093263 1..121 100 -> Plus
3R 27093335..27093581 122..368 100 -> Plus
3R 27093636..27093769 369..502 100 -> Plus
3R 27093826..27094224 503..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:30:56 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27093143..27093263 1..121 100 -> Plus
3R 27093335..27093581 122..368 100 -> Plus
3R 27093636..27093769 369..502 100 -> Plus
3R 27093826..27094224 503..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:30:56 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27093143..27093263 1..121 100 -> Plus
3R 27093335..27093581 122..368 100 -> Plus
3R 27093636..27093769 369..502 100 -> Plus
3R 27093826..27094224 503..901 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:38 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22918865..22918985 1..121 100 -> Plus
arm_3R 22919358..22919491 369..502 100 -> Plus
arm_3R 22919057..22919303 122..368 100 -> Plus
arm_3R 22919548..22919946 503..901 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:28 Download gff for IP09472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26834166..26834412 122..368 100 -> Plus
3R 26834467..26834600 369..502 100 -> Plus
3R 26834657..26835055 503..901 100   Plus
3R 26833974..26834094 1..121 100 -> Plus

IP09472.hyp Sequence

Translation from 0 to 812

> IP09472.hyp
VLVITFWNKIIKMLIKVAKFLSIVAVLLSAVEGAKYLAEKPDFLIPCIVG
DPNFNVCLTKNFQSFFRQWKDGIPGYNAVGSFDPFYIKRVKFTQDASRSI
AINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFDYKVKG
HVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFRE
IKQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLL
DRFKKTFVYVPATYLIKDFH*

IP09472.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14258-PA 258 CG14258-PA 1..258 13..270 1339 100 Plus
CG14457-PB 271 CG14457-PB 7..255 17..268 398 31.7 Plus
CG14457-PC 270 CG14457-PC 7..254 17..268 381 30.6 Plus
CG17189-PA 264 CG17189-PA 2..248 26..268 356 33.7 Plus
CG14259-PA 289 CG14259-PA 10..271 3..268 346 30.6 Plus

IP09472.pep Sequence

Translation from 0 to 812

> IP09472.pep
VLVITFWNKIIKMLIKVAKFLSIVAVLLSAVEGAKYLAEKPDFLIPCIVG
DPNFNVCLTKNFQSFFRQWKDGIPGYNAVGSFDPFYIKRVKFTQDASRSI
AINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFDYKVKG
HVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFRE
IKQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLL
DRFKKTFVYVPATYLIKDFH*

IP09472.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23274-PA 253 GF23274-PA 1..253 13..270 1053 77.9 Plus
Dana\GF10987-PA 272 GF10987-PA 16..256 28..268 408 33.1 Plus
Dana\GF23276-PA 272 GF23276-PA 1..255 15..268 370 32.8 Plus
Dana\GF23275-PA 278 GF23275-PA 11..264 21..268 353 31.9 Plus
Dana\GF11323-PA 261 GF11323-PA 15..247 22..257 222 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11524-PA 258 GG11524-PA 1..258 13..270 1240 89.1 Plus
Dere\GG16269-PA 272 GG16269-PA 25..256 36..268 403 33.5 Plus
Dere\GG11525-PA 290 GG11525-PA 14..271 7..268 346 31.1 Plus
Dere\GG11526-PA 271 GG11526-PA 22..255 36..268 338 32.2 Plus
Dere\GG20212-PA 259 GG20212-PA 24..253 34..259 228 27 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18633-PA 257 GH18633-PA 1..257 13..270 778 54.3 Plus
Dgri\GH18951-PA 261 GH18951-PA 18..260 29..269 465 37 Plus
Dgri\GH16705-PA 271 GH16705-PA 7..255 22..268 411 34 Plus
Dgri\GH18634-PA 279 GH18634-PA 27..265 31..268 329 31.7 Plus
Dgri\GH18635-PA 307 GH18635-PA 57..291 28..268 296 29.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14258-PA 258 CG14258-PA 1..258 13..270 1339 100 Plus
CG14457-PB 271 CG14457-PB 7..255 17..268 398 31.7 Plus
CG14457-PC 270 CG14457-PC 7..254 17..268 381 30.6 Plus
CG17189-PC 271 CG17189-PC 4..255 21..268 360 33.1 Plus
CG17189-PB 271 CG17189-PB 4..255 21..268 360 33.1 Plus
CG14259-PA 289 CG14259-PA 10..271 3..268 346 30.6 Plus
CG10407-PB 259 CG10407-PB 28..248 34..257 228 27.2 Plus
CG10407-PA 259 CG10407-PA 28..248 34..257 228 27.2 Plus
CG10407-PC 263 CG10407-PC 28..252 34..257 213 26.8 Plus
CG14457-PA 144 CG14457-PA 1..128 140..268 202 31 Plus
CG10264-PA 270 CG10264-PA 6..264 5..261 198 23.7 Plus
CG11854-PB 250 CG11854-PB 19..247 36..265 183 23.8 Plus
to-PB 249 CG11853-PB 7..247 22..268 154 22.7 Plus
to-PA 249 CG11853-PA 7..247 22..268 154 22.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24305-PA 261 GI24305-PA 11..261 20..270 762 51.8 Plus
Dmoj\GI23277-PA 263 GI23277-PA 1..261 11..268 487 37.2 Plus
Dmoj\GI13915-PA 271 GI13915-PA 24..255 36..268 390 31.8 Plus
Dmoj\GI24306-PA 271 GI24306-PA 16..259 26..268 348 30.9 Plus
Dmoj\GI24307-PA 273 GI24307-PA 19..257 31..268 348 32.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23899-PA 258 GL23899-PA 1..258 13..270 1015 70.2 Plus
Dper\GL23901-PA 274 GL23901-PA 12..258 23..268 363 33.3 Plus
Dper\GL23900-PA 296 GL23900-PA 33..271 31..268 344 32.8 Plus
Dper\GL12216-PA 269 GL12216-PA 1..264 1..262 210 24.7 Plus
Dper\GL12408-PA 265 GL12408-PA 38..251 41..257 201 25.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12863-PA 258 GA12863-PA 1..258 13..270 1016 70.5 Plus
Dpse\GA27098-PA 258 GA27098-PA 1..258 13..270 1015 70.2 Plus
Dpse\GA12999-PA 278 GA12999-PA 18..262 24..268 408 33.3 Plus
Dpse\GA27099-PA 263 GA27099-PA 1..247 23..268 361 32.3 Plus
Dpse\GA12864-PA 296 GA12864-PA 33..271 31..268 342 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10364-PA 258 GM10364-PA 1..258 13..270 1310 94.6 Plus
Dsec\GM22460-PA 273 GM22460-PA 12..257 20..268 408 32.5 Plus
Dsec\GM10367-PA 271 GM10367-PA 14..255 28..268 371 34 Plus
Dsec\GM10365-PA 289 GM10365-PA 31..271 29..268 349 32.6 Plus
Dsec\GM25738-PA 230 GM25738-PA 6..224 41..259 228 27 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21324-PA 202 GD21324-PA 1..202 13..270 880 70.2 Plus
Dsim\GD15043-PA 271 GD15043-PA 10..255 20..268 407 32.5 Plus
Dsim\GD21326-PA 264 GD21326-PA 7..248 28..268 384 34.4 Plus
Dsim\GD21325-PA 289 GD21325-PA 23..271 21..268 351 32.4 Plus
Dsim\GD19070-PA 270 GD19070-PA 2..265 1..262 204 24.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23083-PA 261 GJ23083-PA 4..261 15..270 846 61.2 Plus
Dvir\GJ24135-PA 263 GJ24135-PA 1..262 11..269 496 37 Plus
Dvir\GJ11649-PA 271 GJ11649-PA 10..255 23..268 418 34.4 Plus
Dvir\GJ23084-PA 273 GJ23084-PA 17..258 28..268 361 32.9 Plus
Dvir\GJ23085-PA 262 GJ23085-PA 1..246 24..268 355 33.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11044-PA 258 GK11044-PA 16..258 27..270 796 59.4 Plus
Dwil\GK16767-PA 272 GK16767-PA 11..256 24..268 412 32.8 Plus
Dwil\GK11048-PA 276 GK11048-PA 22..260 31..268 391 33.8 Plus
Dwil\GK11046-PA 288 GK11046-PA 11..270 14..268 383 31.8 Plus
Dwil\GK11047-PA 286 GK11047-PA 8..268 9..268 377 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23713-PA 258 GE23713-PA 1..258 13..270 1278 93 Plus
Dyak\GE22627-PA 271 GE22627-PA 24..255 36..268 403 33.5 Plus
Dyak\GE23715-PA 268 GE23715-PA 12..252 29..268 355 32.1 Plus
Dyak\GE23714-PA 290 GE23714-PA 31..271 29..268 347 33.5 Plus
Dyak\GE26341-PA 259 GE26341-PA 23..253 29..259 225 26.1 Plus