Clone IP09473 Report

Search the DGRC for IP09473

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:94
Well:73
Vector:pOT2
Associated Gene/TranscriptCG14259-RA
Protein status:IP09473.pep: gold
Preliminary Size:870
Sequenced Size:1136

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14259 2005-01-01 Successful iPCR screen
CG14259 2008-04-29 Release 5.5 accounting
CG14259 2008-08-15 Release 5.9 accounting
CG14259 2008-12-18 5.12 accounting

Clone Sequence Records

IP09473.complete Sequence

1136 bp (1136 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024348

> IP09473.complete
TGACACTGTTTGATGTGACTGAGCAGCGGCTGCCTAGACCGCGATACGTC
TACAGTACTATTCGCTGAGCTACTTAGATACTTAACTACTTGATTAATAA
ACAGTTGCCAAAACGACACCATGAGCAGCACGCGCTACGGCCGCACTTTG
CTCGGCATTTGGAGTGGATTATTGGCCATTTTGTGCCTGAATGAAATCGC
CATGGATAGGTCGTTGGTTTCAGCCGTTGCCTACTACTCCGAAAAACCTG
CCTTTCTGCCATCTTGTCGGATCTACGAACCGGGCTTCACCAAGTGCTCT
ACGAATAGCATTCAGAAGCTTCTTGATCAGTTGAACATTGGAATACCAGA
GGTGCTCGAGCGGTTCGGTCCCTTTGATCCCATGAGAGTTAGGGATATAG
TTTTCAAGCAGGATAACAACGAGGTGGCCACCATCAGAGCCAATCTGACT
GACCTGGTGGTCAAGGGTTTTGCCAACACAAAGGTCAAGGAGAGTCGTGT
GAGCAAGAAAGACTTTAGCTGGCAGACCAAAATATATCTTCCGAAAATGA
GACTGGATGGAAGGTATGAAATGGCTGGACGAATACTCCTTATACCACTG
AGTGGCTCTGGCAAAATATTTATTGAGATTGATGATCTTGACATTTTGCT
ACTAACAAAAATACGTCTGTATGAAAAGGGTGGCTTCACCTTCGACAACG
TGACCGCTGTGCAGGTTCAACTGAATCTGTCCAAAGTGCGCACTTATCTG
GACAATCTATTCAATGGACGTAGCAAGGAGGTGGAGCGCAGTACGAATGA
GTTTTTCAATGAAAACTGGCGGGATTTCTACGAGGCCCTGAAACCACTCA
TCGTTGAGACGGTGGAAAATATCCTTTATGATGTAATGTCTACGGTTTTT
CATTTAATACCAGCCAACTTTTTCGTTGAGGACATACCAACGCCCCAGCA
ACTTTATGGTCCAAAGGAGATACTTGGCAAAAAAGAATAGTTGAGTGATA
TCTATTATTGTTAACTTGTAGTACGCCATCCCCAAATTCTTTCAATATTT
GTAATAAAAATCATTAACGAATAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP09473.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14259-RA 1116 CG14259-RA 44..1116 1..1073 5365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22918446..22918887 631..1072 2210 100 Plus
chr3R 27901430 chr3R 22917870..22918119 248..497 1235 99.6 Plus
chr3R 27901430 chr3R 22917564..22917810 1..247 1205 99.2 Plus
chr3R 27901430 chr3R 22918243..22918377 497..631 660 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27095415..27095857 631..1073 2215 100 Plus
3R 32079331 3R 27094839..27095088 248..497 1250 100 Plus
3R 32079331 3R 27094533..27094779 1..247 1235 100 Plus
3R 32079331 3R 27095212..27095346 497..631 675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26836246..26836688 631..1073 2215 100 Plus
3R 31820162 3R 26835670..26835919 248..497 1250 100 Plus
3R 31820162 3R 26835364..26835610 1..247 1235 100 Plus
3R 31820162 3R 26836043..26836177 497..631 675 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:15:58 has no hits.

IP09473.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:17:03 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22917564..22917810 1..247 99 -> Plus
chr3R 22917870..22918119 248..497 99 -> Plus
chr3R 22918244..22918377 498..631 99 -> Plus
chr3R 22918447..22918887 632..1072 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:40:10 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..870 121..990 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:29 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..870 121..990 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:30:00 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..870 121..990 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:39 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..870 121..990 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:01 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..870 121..990 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:54 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..870 121..990 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:29 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 37..1108 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:30:00 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 37..1108 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:39 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..870 121..990 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:01 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14259-RA 1..1072 1..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:03 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27094839..27095088 248..497 100 -> Plus
3R 27094533..27094779 1..247 100 -> Plus
3R 27095213..27095346 498..631 100 -> Plus
3R 27095416..27095856 632..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:03 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27094839..27095088 248..497 100 -> Plus
3R 27094533..27094779 1..247 100 -> Plus
3R 27095213..27095346 498..631 100 -> Plus
3R 27095416..27095856 632..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:03 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27094839..27095088 248..497 100 -> Plus
3R 27094533..27094779 1..247 100 -> Plus
3R 27095213..27095346 498..631 100 -> Plus
3R 27095416..27095856 632..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:30:00 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22920255..22920501 1..247 100 -> Plus
arm_3R 22920561..22920810 248..497 100 -> Plus
arm_3R 22920935..22921068 498..631 100 -> Plus
arm_3R 22921138..22921578 632..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:56 Download gff for IP09473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26835364..26835610 1..247 100 -> Plus
3R 26835670..26835919 248..497 100 -> Plus
3R 26836044..26836177 498..631 100 -> Plus
3R 26836247..26836687 632..1072 100   Plus

IP09473.pep Sequence

Translation from 120 to 989

> IP09473.pep
MSSTRYGRTLLGIWSGLLAILCLNEIAMDRSLVSAVAYYSEKPAFLPSCR
IYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNN
EVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYE
MAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQ
LNLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVEN
ILYDVMSTVFHLIPANFFVEDIPTPQQLYGPKEILGKKE*

IP09473.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23275-PA 278 GF23275-PA 1..277 1..284 1282 85.6 Plus
Dana\GF23276-PA 272 GF23276-PA 17..266 33..282 868 62 Plus
Dana\GF10987-PA 272 GF10987-PA 6..265 13..280 643 45.5 Plus
Dana\GF23274-PA 253 GF23274-PA 17..251 31..271 331 32.2 Plus
Dana\GF11323-PA 261 GF11323-PA 27..255 40..272 283 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11525-PA 290 GG11525-PA 1..288 1..288 1441 93.4 Plus
Dere\GG11526-PA 271 GG11526-PA 19..266 35..282 872 63.3 Plus
Dere\GG16269-PA 272 GG16269-PA 24..265 37..280 623 47.1 Plus
Dere\GG11524-PA 258 GG11524-PA 17..256 31..271 346 31.4 Plus
Dere\GG20212-PA 259 GG20212-PA 35..256 43..272 258 28.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18634-PA 279 GH18634-PA 1..274 1..280 1089 70.7 Plus
Dgri\GH18635-PA 307 GH18635-PA 7..302 18..282 808 52 Plus
Dgri\GH16705-PA 271 GH16705-PA 23..271 37..287 613 46.2 Plus
Dgri\GH18951-PA 261 GH18951-PA 18..259 31..271 331 30.7 Plus
Dgri\GH18633-PA 257 GH18633-PA 3..255 9..271 320 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14259-PA 289 CG14259-PA 1..289 1..289 1485 100 Plus
CG17189-PC 271 CG17189-PC 20..266 36..282 885 65.2 Plus
CG17189-PB 271 CG17189-PB 20..266 36..282 885 65.2 Plus
CG14457-PC 270 CG14457-PC 17..263 32..280 607 46.6 Plus
CG14457-PB 271 CG14457-PB 24..264 38..280 606 46.9 Plus
CG14457-PA 144 CG14457-PA 1..137 143..280 404 52.9 Plus
CG14258-PA 258 CG14258-PA 9..256 23..271 344 32 Plus
CG10407-PB 259 CG10407-PB 35..256 43..272 257 28.9 Plus
CG10407-PA 259 CG10407-PA 35..256 43..272 257 28.9 Plus
CG10264-PA 270 CG10264-PA 18..269 16..269 244 23.4 Plus
CG10407-PC 263 CG10407-PC 35..260 43..272 242 28.4 Plus
CG11854-PB 250 CG11854-PB 23..243 52..264 203 25.7 Plus
CG13618-PA 252 CG13618-PA 4..245 14..264 197 25.6 Plus
CG11852-PA 250 CG11852-PA 1..238 18..260 190 25.9 Plus
CG1124-PA 246 CG1124-PA 19..246 40..271 180 21.6 Plus
CG2016-PD 249 CG2016-PD 18..246 38..269 174 21.9 Plus
CG2016-PB 249 CG2016-PB 18..246 38..269 174 21.9 Plus
CG7079-PB 255 CG7079-PB 23..243 43..264 174 26.8 Plus
CG7079-PA 255 CG7079-PA 23..243 43..264 174 26.8 Plus
CG2016-PE 254 CG2016-PE 18..251 38..269 173 21.9 Plus
CG17279-PD 245 CG17279-PD 20..245 43..271 167 23 Plus
CG31189-PB 258 CG31189-PB 33..239 55..260 163 24.8 Plus
CG5945-PB 250 CG5945-PB 6..250 16..271 162 20.9 Plus
CG5945-PA 250 CG5945-PA 6..250 16..271 162 20.9 Plus
CG14661-PB 246 CG14661-PB 24..224 43..249 161 23.7 Plus
CG14661-PA 246 CG14661-PA 24..224 43..249 161 23.7 Plus
to-PB 249 CG11853-PB 60..248 86..271 156 24.2 Plus
to-PA 249 CG11853-PA 60..248 86..271 156 24.2 Plus
CG5867-PA 262 CG5867-PA 34..259 41..269 153 20.3 Plus
CG2650-PA 260 CG2650-PA 5..258 7..270 148 22.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24306-PA 271 GI24306-PA 10..271 16..283 1081 74.3 Plus
Dmoj\GI24307-PA 273 GI24307-PA 19..271 33..285 862 61.7 Plus
Dmoj\GI10889-PA 161 GI10889-PA 2..161 124..283 701 79.4 Plus
Dmoj\GI13915-PA 271 GI13915-PA 24..264 38..280 619 47.3 Plus
Dmoj\GI24305-PA 261 GI24305-PA 15..259 26..271 344 29.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23900-PA 296 GL23900-PA 3..286 2..286 1291 84.6 Plus
Dper\GL23901-PA 274 GL23901-PA 20..269 33..282 873 62.4 Plus
Dper\GL23899-PA 258 GL23899-PA 24..256 38..271 353 30.4 Plus
Dper\GL12408-PA 265 GL12408-PA 35..251 40..260 241 24.9 Plus
Dper\GL12216-PA 269 GL12216-PA 28..268 27..269 236 23.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12864-PA 296 GA12864-PA 3..286 2..286 1289 84.2 Plus
Dpse\GA23226-PA 296 GA23226-PA 3..286 2..286 1284 84.2 Plus
Dpse\GA27099-PA 263 GA27099-PA 9..258 33..282 868 62.4 Plus
Dpse\GA12999-PA 278 GA12999-PA 9..271 14..280 643 47.8 Plus
Dpse\GA27098-PA 258 GA27098-PA 24..256 38..271 353 30.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10365-PA 289 GM10365-PA 1..289 1..289 1501 97.2 Plus
Dsec\GM10367-PA 271 GM10367-PA 17..266 33..282 912 65.2 Plus
Dsec\GM22460-PA 273 GM22460-PA 13..266 26..280 624 46.5 Plus
Dsec\GM10364-PA 258 GM10364-PA 9..256 23..271 370 33.6 Plus
Dsec\GM25738-PA 230 GM25738-PA 6..229 43..264 263 29.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21325-PA 289 GD21325-PA 1..289 1..289 1502 97.6 Plus
Dsim\GD21326-PA 264 GD21326-PA 10..259 33..282 910 64.8 Plus
Dsim\GD15043-PA 271 GD15043-PA 11..264 26..280 624 46.5 Plus
Dsim\GD19070-PA 270 GD19070-PA 29..269 27..269 242 24.1 Plus
Dsim\GD21191-PA 250 GD21191-PA 14..243 33..264 218 26.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23084-PA 273 GJ23084-PA 5..267 11..280 1084 72.2 Plus
Dvir\GJ23085-PA 262 GJ23085-PA 8..257 33..282 891 64.4 Plus
Dvir\GJ11649-PA 271 GJ11649-PA 24..264 38..280 607 47.3 Plus
Dvir\GJ23083-PA 261 GJ23083-PA 15..259 26..271 361 31.2 Plus
Dvir\GJ24135-PA 263 GJ24135-PA 7..261 11..271 327 28.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11047-PA 286 GK11047-PA 3..283 4..286 1169 77 Plus
Dwil\GK11046-PA 288 GK11046-PA 11..281 10..282 1151 78 Plus
Dwil\GK11048-PA 276 GK11048-PA 21..271 32..282 887 64.5 Plus
Dwil\GK16767-PA 272 GK16767-PA 2..265 15..280 627 46.2 Plus
Dwil\GK11044-PA 258 GK11044-PA 18..256 31..271 379 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23714-PA 290 GE23714-PA 1..288 1..288 1441 93.4 Plus
Dyak\GE23715-PA 268 GE23715-PA 14..263 33..282 903 64 Plus
Dyak\GE22627-PA 271 GE22627-PA 23..264 37..280 620 47.1 Plus
Dyak\GE23713-PA 258 GE23713-PA 9..257 23..272 358 31.5 Plus
Dyak\GE26341-PA 259 GE26341-PA 35..256 43..272 260 28.4 Plus

IP09473.hyp Sequence

Translation from 120 to 989

> IP09473.hyp
MSSTRYGRTLLGIWSGLLAILCLNEIAMDRSLVSAVAYYSEKPAFLPSCR
IYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNN
EVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYE
MAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQ
LNLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVEN
ILYDVMSTVFHLIPANFFVEDIPTPQQLYGPKEILGKKE*

IP09473.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14259-PA 289 CG14259-PA 1..289 1..289 1485 100 Plus
CG17189-PA 264 CG17189-PA 13..259 36..282 885 65.2 Plus
CG14457-PC 270 CG14457-PC 17..263 32..280 607 46.6 Plus
CG14457-PB 271 CG14457-PB 24..264 38..280 606 46.9 Plus
CG14457-PA 144 CG14457-PA 1..137 143..280 404 52.9 Plus