Clone IP09476 Report

Search the DGRC for IP09476

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:94
Well:76
Vector:pOT2
Associated Gene/TranscriptCG14297-RA
Protein status:IP09476.pep: gold
Preliminary Size:928
Sequenced Size:961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14297 2008-04-29 Release 5.5 accounting
CG14297 2008-08-15 Release 5.9 accounting
CG14297 2008-12-18 5.12 accounting

Clone Sequence Records

IP09476.complete Sequence

961 bp (961 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023575

> IP09476.complete
AAGAAGTTAGGAAAATTAGTTTAAATTATAGTTGAAAGTGGGAGAATTTA
GCCAAGTAAAACGTATAAAGAGAAAAATAAAAATGACTTTCAAGAAAATA
CTATTTGTGTGCATGGGCAACTCGTGCAGCTCTCCGATGGCCGAGGTGAT
TATGCAGAATCTGATGGTCAAGACGAGTCTCTACTGGGAGGTGGATAGTG
CCGGTCTGAGGACATGGAACACTGGACGGCGACCGAACAAGCGATGCCTG
CAAATTCTGCGAGAGCACGGACTGCGATCCGATCACTTTTGTCGTCAGTT
CACCGTGAATGATTTTCTGTACTTTGATTATGTTGTGGCAATGGATGAGG
CCGTGTTCAAAGAACTGCTCCTCTGGGCTGCGGACAACAGGGCTGGCAAA
CACTGTCAGGTACTTCTTCTGAGTTCGTTTGGCAAGAATGGACTGCCGGC
CTTTATAGACAGCCTATCCCCAACCCACAAGCTAAAGAACTTTCGATCCG
CCTATTACCAAATCAAAGAGTGCTGCAAGCAGCTCATCCTTAGCCAAAAA
GTGGACATTGTCAAGTACGAGCTACCCAGCACTGATGATGATGAGCTCTA
CTACTCTGGCAAGGATAATGCGCCGCAGGACTCGGCCAAGGCGAATCACT
TGACGGAAACAAGCCATAACAACAGTGGCATATATCTGCTAAACACGGAG
ATAAGATCCTCCGGTGGACTGATGTCCTCGTCGACCGACCCATCCAACTC
GAAGACCTCGATGCCATCCTGCAGCCAAGGAGTGCAGCGAAAACTGTGCC
AGAAATGTGGACAGAAATTTCTGGCTGCCCTTTAGTGTCAAGAACTAATA
TTCAAAGGCGGCAAATTAACCTTGCGCTTAGATTATGTAGCGTATGAAAT
TAAATAAAATTGACTTTTATCTGGCAGCTGTCCGCCGTCTATAAAAAAAA
AAAAAAAAAAA

IP09476.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14297-RA 1037 CG14297-RA 96..1037 1..942 4710 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14722860..14723329 473..942 2320 99.6 Plus
chr3R 27901430 chr3R 14722380..14722562 116..298 915 100 Plus
chr3R 27901430 chr3R 14722622..14722797 297..472 880 100 Plus
chr3R 27901430 chr3R 14722198..14722314 1..117 585 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18898873..18899344 473..944 2360 100 Plus
3R 32079331 3R 18898393..18898575 116..298 915 100 Plus
3R 32079331 3R 18898635..18898810 297..472 880 100 Plus
3R 32079331 3R 18898211..18898327 1..117 585 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18639704..18640175 473..944 2360 100 Plus
3R 31820162 3R 18639224..18639406 116..298 915 100 Plus
3R 31820162 3R 18639466..18639641 297..472 880 100 Plus
3R 31820162 3R 18639042..18639158 1..117 585 100 Plus
Blast to na_te.dros performed 2019-03-16 07:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 1131..1175 54..99 109 78.7 Plus

IP09476.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:29:29 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14722198..14722313 1..116 100 -> Plus
chr3R 14722381..14722562 117..298 100 -> Plus
chr3R 14722624..14722797 299..472 100 -> Plus
chr3R 14722860..14723329 473..942 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:40:13 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 1..753 83..835 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:59 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 1..753 83..835 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:31:43 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 1..753 83..835 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:31 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 1..753 83..835 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:39 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 1..753 83..835 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:44:20 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 94..1035 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:59 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 91..1032 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:43 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 91..1032 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:31 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 94..1035 1..942 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:39 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
CG14297-RA 91..1032 1..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:29 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18898637..18898810 299..472 100 -> Plus
3R 18898211..18898326 1..116 100 -> Plus
3R 18898394..18898575 117..298 100 -> Plus
3R 18898873..18899342 473..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:29 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18898637..18898810 299..472 100 -> Plus
3R 18898211..18898326 1..116 100 -> Plus
3R 18898394..18898575 117..298 100 -> Plus
3R 18898873..18899342 473..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:29 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18898637..18898810 299..472 100 -> Plus
3R 18898211..18898326 1..116 100 -> Plus
3R 18898394..18898575 117..298 100 -> Plus
3R 18898873..18899342 473..942 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:43 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14724116..14724297 117..298 100 -> Plus
arm_3R 14724359..14724532 299..472 100 -> Plus
arm_3R 14723933..14724048 1..116 100 -> Plus
arm_3R 14724595..14725064 473..942 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:30 Download gff for IP09476.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18639704..18640173 473..942 100   Plus
3R 18639042..18639157 1..116 100 -> Plus
3R 18639225..18639406 117..298 100 -> Plus
3R 18639468..18639641 299..472 100 -> Plus

IP09476.pep Sequence

Translation from 82 to 834

> IP09476.pep
MTFKKILFVCMGNSCSSPMAEVIMQNLMVKTSLYWEVDSAGLRTWNTGRR
PNKRCLQILREHGLRSDHFCRQFTVNDFLYFDYVVAMDEAVFKELLLWAA
DNRAGKHCQVLLLSSFGKNGLPAFIDSLSPTHKLKNFRSAYYQIKECCKQ
LILSQKVDIVKYELPSTDDDELYYSGKDNAPQDSAKANHLTETSHNNSGI
YLLNTEIRSSGGLMSSSTDPSNSKTSMPSCSQGVQRKLCQKCGQKFLAAL
*

IP09476.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23217-PA 294 GF23217-PA 1..294 1..250 858 58 Plus
Dana\GF18148-PA 157 GF18148-PA 2..150 5..152 299 39.6 Plus
Dana\GF18147-PA 155 GF18147-PA 3..145 4..148 226 35.6 Plus
Dana\GF18146-PA 164 GF18146-PA 10..155 6..152 191 31.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23073-PA 249 GG23073-PA 1..249 1..250 1215 88.8 Plus
Dere\GG17027-PA 165 GG17027-PA 2..156 5..158 320 41.3 Plus
Dere\GG17025-PA 155 GG17025-PA 3..145 4..148 232 35.4 Plus
Dere\GG17024-PA 164 GG17024-PA 10..146 6..155 219 34.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14482-PA 234 GH14482-PA 1..234 1..250 701 56.2 Plus
Dgri\GH14047-PA 155 GH14047-PA 2..150 5..152 305 38.9 Plus
Dgri\GH14046-PA 155 GH14046-PA 3..146 4..149 247 37.4 Plus
Dgri\GH14045-PA 168 GH14045-PA 9..104 4..97 185 36.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14297-PA 250 CG14297-PA 1..250 1..250 1322 100 Plus
CG31469-PA 164 CG31469-PA 2..164 5..166 305 40.5 Plus
primo-1-PB 155 CG33748-PB 3..145 4..148 227 34.9 Plus
primo-1-PA 155 CG33748-PA 3..145 4..148 227 34.9 Plus
primo-2-PC 164 CG33747-PC 10..155 6..152 209 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22967-PA 239 GI22967-PA 1..239 1..250 736 57.5 Plus
Dmoj\GI24422-PA 157 GI24422-PA 2..150 5..152 293 39.6 Plus
Dmoj\GI24420-PA 156 GI24420-PA 1..150 1..152 236 36.1 Plus
Dmoj\GI24419-PA 165 GI24419-PA 8..119 4..116 209 33 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23438-PA 260 GL23438-PA 1..260 1..250 738 55.1 Plus
Dper\GL24449-PA 165 GL24449-PA 2..150 5..152 313 40.9 Plus
Dper\GL24448-PA 159 GL24448-PA 8..150 4..148 215 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12886-PA 260 GA12886-PA 1..260 1..250 746 55.8 Plus
Dpse\GA16272-PA 165 GA16272-PA 2..150 5..152 318 41.6 Plus
Dpse\GA16170-PB 154 GA16170-PB 3..145 4..148 220 34.2 Plus
Dpse\GA16170-PC 137 GA16170-PC 3..137 4..134 211 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17892-PA 250 GM17892-PA 1..250 1..250 1305 96 Plus
Dsec\GM25911-PA 159 GM25911-PA 2..150 5..152 305 40.9 Plus
Dsec\GM25909-PA 155 GM25909-PA 3..145 4..148 228 34.7 Plus
Dsec\GM25908-PA 164 GM25908-PA 10..146 6..155 218 32.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19253-PA 250 GD19253-PA 1..250 1..250 1311 96 Plus
Dsim\GD20478-PA 165 GD20478-PA 2..150 5..152 309 41.6 Plus
Dsim\GD20476-PA 164 GD20476-PA 10..146 6..155 221 32.9 Plus
Dsim\GD20477-PA 150 GD20477-PA 3..140 4..148 212 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14544-PA 235 GJ14544-PA 1..235 1..250 735 58 Plus
Dvir\GJ14280-PA 157 GJ14280-PA 2..150 5..152 306 39.6 Plus
Dvir\GJ14279-PA 155 GJ14279-PA 3..149 4..152 250 36 Plus
Dvir\GJ14278-PA 168 GJ14278-PA 9..149 4..155 218 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22744-PA 228 GK22744-PA 1..228 1..250 727 58.9 Plus
Dwil\GK13064-PA 160 GK13064-PA 2..156 5..158 346 43.9 Plus
Dwil\GK13063-PA 155 GK13063-PA 3..149 4..152 241 36.7 Plus
Dwil\GK13060-PA 164 GK13060-PA 7..146 4..155 225 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25562-PA 249 GE25562-PA 1..249 1..250 1153 88.4 Plus
Dyak\GE24419-PA 165 GE24419-PA 2..156 5..158 320 41.9 Plus
Dyak\primo-1-PA 155 GE24418-PA 3..145 4..148 235 34.9 Plus
Dyak\GE24417-PA 164 GE24417-PA 10..146 6..155 210 32.2 Plus

IP09476.hyp Sequence

Translation from 82 to 834

> IP09476.hyp
MTFKKILFVCMGNSCSSPMAEVIMQNLMVKTSLYWEVDSAGLRTWNTGRR
PNKRCLQILREHGLRSDHFCRQFTVNDFLYFDYVVAMDEAVFKELLLWAA
DNRAGKHCQVLLLSSFGKNGLPAFIDSLSPTHKLKNFRSAYYQIKECCKQ
LILSQKVDIVKYELPSTDDDELYYSGKDNAPQDSAKANHLTETSHNNSGI
YLLNTEIRSSGGLMSSSTDPSNSKTSMPSCSQGVQRKLCQKCGQKFLAAL
*

IP09476.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14297-PA 250 CG14297-PA 1..250 1..250 1322 100 Plus
CG31469-PA 164 CG31469-PA 2..164 5..166 305 40.5 Plus
primo-1-PB 155 CG33748-PB 3..145 4..148 227 34.9 Plus
primo-1-PA 155 CG33748-PA 3..145 4..148 227 34.9 Plus
primo-2-PC 164 CG33747-PC 10..155 6..152 209 31.5 Plus