Clone IP09539 Report

Search the DGRC for IP09539

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:95
Well:39
Vector:pOT2
Associated Gene/TranscriptCG12914-RA
Protein status:IP09539.pep: gold
Preliminary Size:768
Sequenced Size:1275

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12914 2008-04-29 Release 5.5 accounting
CG12914 2008-08-15 Release 5.9 accounting
CG12914 2008-12-18 5.12 accounting

Clone Sequence Records

IP09539.complete Sequence

1275 bp (1275 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024345

> IP09539.complete
GAATACTTTCAATGAATATAAAATCATTCATTGCAAAATGTAAAATGGGA
GTTAGGCAGTTACACAACATACAGAATTCGCAAAATTTTTGTATGGCCGT
ACTTTGCTGGTCATTTACGTGCCGCAAATGAGTTTTCACACCTCAAAACC
AACCGGAAGTTTGATGTTTTTCTCATAAATTTAGATGTGAATCGAAACAA
GCCACTCCAAATACAGTTTCAGAACTAGAGCGTCTGTACATATGTTGCGC
GAAAACCCCCCACCGCGCCAAAAGAGTTGGGTGGGACCCACGTACAGAGT
AACCATAATTATGCTCGTCATCGGACAGATTCAGGTCTCGGTGGCGATGG
AGATCACTCCCCTGAAGGAATTTCTCGCAGATCGCTACTACCTCAGTCTC
GTGCAATTTGTCGTCAGCTTCCTATCCATCCAGCTCTACGGATTTTTCTA
CCACATAATCGTTAAAAAGCCTATGTGGGTGCGGTTATTGGCGGGCCTCT
GGACGTACGAGGTGAACACCATGTCGATCATGAAGCCCGCCAAACGTGCC
CCTTATATAAGCCTCATCCTGTCAATCTTCCTAACATTCCTTATGATGAT
CATCAGTGTGATATACGGAAATAGTGCCATCAAACACAAGAAAGGCCTTT
TCACTACCCGGCATAAGGTTATCCTGTGGAGCGAGCGCATATTTGTCCTC
ACCTGCTTTGGCATCATCGTGTGTGCCGAGATGAAGCGTGTTATCATAGA
GTTTCCAACCCTGCTAGTATACACCATTCTCTCGAGCGTGTTTGTCATAG
TCTTTGGCGCTTCCATGCGAAAGCCGAACTTCTACCGCCAGGAGTCGACC
GGGGACTACATACTGATCGGCCAGCTGTACTACCTCAACTTTTTTGCCCT
ATATATGGGCTATGTGTGGACGACAGCCTCGTTTATAGAATTGATGGGAT
GGCGCGCGGACATTCATGATATATTCGTGTACCTGTTCTATCGGAAGAAC
ATCGAATGAGTGGAACGCATGCGTGGACTATCGGAACAGCTGGGACAGAA
TGTTTATGCGAGACGATTCAGTTCCTGCGGCAATTGGTCAGTGCCTCGAT
GTCGATGGGGCAAGTTTGTCTGGGTGCCCGCGACTGCTGTCGTCTTGTTT
CGATTCGGTTTGCCGGAAAATCGATAACTGTTTCCATGGCACGCGCATCT
TAAGCAAAAACGCTGAATGTAAATAAATGGCTCTGTCCGCGAAACGTTTC
CATAAAAAAAAAAAAAAAAAAAAAA

IP09539.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12914-RA 1257 CG12914-RA 1..1257 1..1257 6285 100 Plus
CG12914.a 1255 CG12914.a 158..766 183..791 3045 100 Plus
CG12914.a 1255 CG12914.a 788..1255 790..1257 2340 100 Plus
CG12914.a 1255 CG12914.a 1..159 1..159 795 100 Plus
CG12913-RA 1991 CG12913-RA 1..153 1105..1257 765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6136468..6136931 790..1253 2320 100 Plus
chr2R 21145070 chr2R 6135575..6135771 158..354 985 100 Plus
chr2R 21145070 chr2R 6135341..6135499 1..159 795 100 Plus
chr2R 21145070 chr2R 6135839..6135989 355..505 740 99.3 Plus
chr2R 21145070 chr2R 6136051..6136198 505..652 740 100 Plus
chr2R 21145070 chr2R 6136248..6136385 653..790 660 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10248941..10249408 790..1257 2340 100 Plus
2R 25286936 2R 10248048..10248244 158..354 985 100 Plus
2R 25286936 2R 10247814..10247972 1..159 795 100 Plus
2R 25286936 2R 10248312..10248462 355..505 755 100 Plus
2R 25286936 2R 10248524..10248671 505..652 740 100 Plus
2R 25286936 2R 10248721..10248858 653..790 690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10250140..10250607 790..1257 2340 100 Plus
2R 25260384 2R 10249247..10249443 158..354 985 100 Plus
2R 25260384 2R 10249013..10249171 1..159 795 100 Plus
2R 25260384 2R 10249511..10249661 355..505 755 100 Plus
2R 25260384 2R 10249723..10249870 505..652 740 100 Plus
2R 25260384 2R 10249920..10250057 653..790 690 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:40:21 has no hits.

IP09539.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:41:21 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6135341..6135499 1..159 100 -> Plus
chr2R 6135577..6135771 160..354 100 -> Plus
chr2R 6135839..6135989 355..505 99 -> Plus
chr2R 6136052..6136198 506..652 100 -> Plus
chr2R 6136248..6136385 653..790 98 -> Plus
chr2R 6136469..6136931 791..1253 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:40:36 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..768 242..1009 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:35:42 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..768 242..1009 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:55:27 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..768 242..1009 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:24 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..768 242..1009 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:00:18 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..768 242..1009 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:11 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..1253 1..1253 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:35:42 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..1253 1..1253 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:55:27 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..1253 1..1253 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:24 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..1253 1..1253 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:00:18 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
CG12914-RA 1..1253 1..1253 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:21 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10247814..10247972 1..159 100 -> Plus
2R 10248050..10248244 160..354 100 -> Plus
2R 10248312..10248462 355..505 100 -> Plus
2R 10248525..10248671 506..652 100 -> Plus
2R 10248721..10248858 653..790 100 -> Plus
2R 10248942..10249404 791..1253 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:21 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10247814..10247972 1..159 100 -> Plus
2R 10248050..10248244 160..354 100 -> Plus
2R 10248312..10248462 355..505 100 -> Plus
2R 10248525..10248671 506..652 100 -> Plus
2R 10248721..10248858 653..790 100 -> Plus
2R 10248942..10249404 791..1253 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:21 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10247814..10247972 1..159 100 -> Plus
2R 10248050..10248244 160..354 100 -> Plus
2R 10248312..10248462 355..505 100 -> Plus
2R 10248525..10248671 506..652 100 -> Plus
2R 10248721..10248858 653..790 100 -> Plus
2R 10248942..10249404 791..1253 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:55:27 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6135555..6135749 160..354 100 -> Plus
arm_2R 6135817..6135967 355..505 100 -> Plus
arm_2R 6136030..6136176 506..652 100 -> Plus
arm_2R 6135319..6135477 1..159 100 -> Plus
arm_2R 6136226..6136363 653..790 100 -> Plus
arm_2R 6136447..6136909 791..1253 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:26 Download gff for IP09539.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10250141..10250603 791..1253 100   Plus
2R 10249013..10249171 1..159 100 -> Plus
2R 10249249..10249443 160..354 100 -> Plus
2R 10249511..10249661 355..505 100 -> Plus
2R 10249724..10249870 506..652 100 -> Plus
2R 10249920..10250057 653..790 100 -> Plus

IP09539.pep Sequence

Translation from 241 to 1008

> IP09539.pep
MLRENPPPRQKSWVGPTYRVTIIMLVIGQIQVSVAMEITPLKEFLADRYY
LSLVQFVVSFLSIQLYGFFYHIIVKKPMWVRLLAGLWTYEVNTMSIMKPA
KRAPYISLILSIFLTFLMMIISVIYGNSAIKHKKGLFTTRHKVILWSERI
FVLTCFGIIVCAEMKRVIIEFPTLLVYTILSSVFVIVFGASMRKPNFYRQ
ESTGDYILIGQLYYLNFFALYMGYVWTTASFIELMGWRADIHDIFVYLFY
RKNIE*

IP09539.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12785-PA 246 GF12785-PA 1..239 1..239 643 52.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24152-PA 255 GG24152-PA 1..255 1..255 1211 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21774-PA 247 GH21774-PA 16..246 14..244 771 61.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12914-PA 255 CG12914-PA 1..255 1..255 1320 100 Plus
CG12914-PB 250 CG12914-PB 1..250 1..255 1276 98 Plus
CG12914-PC 193 CG12914-PC 1..192 1..192 938 96.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19321-PA 243 GI19321-PA 19..239 17..237 815 69.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11583-PA 223 GL11583-PA 1..222 24..245 828 68.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11905-PA 247 GA11905-PA 6..246 5..245 870 66.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21195-PA 255 GM21195-PA 1..255 1..255 1321 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10723-PA 255 GD10723-PA 1..255 1..255 1327 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22199-PA 250 GJ22199-PA 5..247 3..245 798 58.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17783-PA 244 GK17783-PA 12..242 11..241 857 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19347-PA 255 GE19347-PA 1..255 1..255 1235 91 Plus

IP09539.hyp Sequence

Translation from 241 to 1008

> IP09539.hyp
MLRENPPPRQKSWVGPTYRVTIIMLVIGQIQVSVAMEITPLKEFLADRYY
LSLVQFVVSFLSIQLYGFFYHIIVKKPMWVRLLAGLWTYEVNTMSIMKPA
KRAPYISLILSIFLTFLMMIISVIYGNSAIKHKKGLFTTRHKVILWSERI
FVLTCFGIIVCAEMKRVIIEFPTLLVYTILSSVFVIVFGASMRKPNFYRQ
ESTGDYILIGQLYYLNFFALYMGYVWTTASFIELMGWRADIHDIFVYLFY
RKNIE*

IP09539.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12914-PA 255 CG12914-PA 1..255 1..255 1320 100 Plus
CG12914-PB 250 CG12914-PB 1..250 1..255 1276 98 Plus
CG12914-PC 193 CG12914-PC 1..192 1..192 938 96.4 Plus