Clone IP09635 Report

Search the DGRC for IP09635

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:96
Well:35
Vector:pOT2
Associated Gene/TranscriptCG17026-RA
Protein status:IP09635.pep: gold
Preliminary Size:855
Sequenced Size:1010

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17026 2008-04-29 Picked prior to 5.5
CG17026 2008-08-15 Release 5.9 accounting
CG17026 2008-12-18 5.12 accounting

Clone Sequence Records

IP09635.complete Sequence

1010 bp assembled on 2008-06-09

GenBank Submission: BT033051

> IP09635.complete
GAACAGGTGCAATATATCGCAAAAGCATTGCAAGATACACAGATAGGTAG
ATAAGCAAATTGGAGAAGTAACTGAGATGGCAGCCAGTAAGTCCCAGATC
GAGGAGCTGTACGACTTTATCTATCCGCTCGCAGTGAGAGCTGGGGAAAT
CCTGTTGGAAGGCTATCAAAATGCTGGCAAGGCGGTGGCCCTCAAGGACG
GGGAGTTCTATAATGTAGTCACTGCCTATGATAACCAGATAGAGGAGTTT
CTCGTGGAGAAAATACTGGCGCGCTACCCGGATCACAAATTCATTGGGGA
AGAGGATACCCACAAGAATGACAATGTAACGAAAGAGCTGACGGATGCTC
CAACTTGGATCATAGATCCCATCGATGGAACCTCGAACTTTATCAAACAA
ATTCCACATGTCTCGGTTTCAATTGGATTGTCCATTAAGAAACAGATCGT
GCTGGGTGTAGTTAACAATCCCGCACAGAATAAGTTATATACCGCGAAAT
TGGGCCAGGGTGCCTTTTGCAATGGGAAACCAATTCAGGTGAGCAGCTGT
GAACATCTCAACGATGCTAATGTGGCATACGAGGTTTGCTTGCTGCACGC
TCCAAAGATCCGGAACAAGCACATCAAAAGAATCTACCATGTGGGATCCA
ATGCCAGAAGACTCCTGGCATATTCCGCTGTAGTGGATTCCCTTTGCATG
GTGGCCGCAGGCAACTTGGATGCCTTTCATATTGAAGACATGTATCCCTG
GGATTGTGCAGCTGGCTATTTGCTCATCCGTGAGGCCGGCGGAGTTGTCA
CGCATCCCTACGGCGGACCCTTCGATATCATGAAGCCAGATCTAATCTGC
GCCGGAACGGAGACACTGAGAGCTGAGATAGAGCATCTTATTCGGAAGGC
TGATCAGGAGAAGCATGTGGGAGGAGAGTGAGATTTGTAAGCCACACGCA
AAGAGCTTTTGTCAACAAATAAAAGTTTAATGATCAACATAAAAAAAAAA
AAAAAAAAAA

IP09635.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG17026-RA 1215 CG17026-RA 58..1051 1..994 4970 100 Plus
CG17027-RA 1775 CG17027-RA 743..958 334..549 510 82.4 Plus
CG17027-RA 1775 CG17027-RA 1023..1176 614..767 365 82.4 Plus
CG17027-RA 1775 CG17027-RA 627..715 218..306 205 82 Plus
CG17027-RA 1775 CG17027-RA 1191..1272 782..863 200 82.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15965193..15965852 1..660 3300 100 Plus
chr3L 24539361 chr3L 15965908..15966239 659..990 1660 100 Plus
chr3L 24539361 chr3L 15970315..15970755 218..658 735 77.8 Plus
chr3L 24539361 chr3L 15971008..15971192 679..863 355 79.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15975382..15976041 1..660 3300 100 Plus
3L 28110227 3L 15976097..15976432 659..994 1680 100 Plus
3L 28110227 3L 15980511..15980951 218..658 735 77.8 Plus
3L 28110227 3L 15981203..15981387 679..863 355 79.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15968482..15969141 1..660 3300 100 Plus
3L 28103327 3L 15969197..15969532 659..994 1680 100 Plus
3L 28103327 3L 15973727..15973942 334..549 510 82.4 Plus
3L 28103327 3L 15974303..15974391 679..767 235 84.2 Plus
3L 28103327 3L 15973611..15973699 218..306 205 82 Plus
3L 28103327 3L 15974406..15974487 782..863 200 82.9 Plus
3L 28103327 3L 15971901..15971948 335..382 165 89.5 Plus
3L 28103327 3L 15970434..15970489 335..390 160 85.7 Plus
3L 28103327 3L 15974007..15974051 614..658 150 88.8 Plus
Blast to na_te.dros performed 2019-03-15 16:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3670..3728 886..829 112 67.8 Minus

IP09635.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:35:34 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15965193..15965852 1..660 100 -> Plus
chr3L 15965910..15966239 661..990 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:41:12 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..855 77..931 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:51 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..855 77..931 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:19:00 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..855 77..931 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:46:18 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..855 77..931 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:36 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..855 77..931 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:43:04 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..855 77..931 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:51 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..990 1..990 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:19:00 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 15..1004 1..990 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:46:18 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 1..855 77..931 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:36 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
CG17026-RA 15..1004 1..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:34 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15975382..15976041 1..660 100 -> Plus
3L 15976099..15976428 661..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:34 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15975382..15976041 1..660 100 -> Plus
3L 15976099..15976428 661..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:34 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15975382..15976041 1..660 100 -> Plus
3L 15976099..15976428 661..990 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:19:00 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15968482..15969141 1..660 100 -> Plus
arm_3L 15969199..15969528 661..990 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:45 Download gff for IP09635.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15968482..15969141 1..660 100 -> Plus
3L 15969199..15969528 661..990 100   Plus

IP09635.pep Sequence

Translation from 76 to 930

> IP09635.pep
MAASKSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTA
YDNQIEEFLVEKILARYPDHKFIGEEDTHKNDNVTKELTDAPTWIIDPID
GTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLYTAKLGQGAFCNG
KPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLAYS
AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFD
IMKPDLICAGTETLRAEIEHLIRKADQEKHVGGE*

IP09635.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24102-PA 286 GF24102-PA 1..283 1..283 1413 91.9 Plus
Dana\GF24105-PA 288 GF24105-PA 6..284 5..284 1178 76.1 Plus
Dana\GF24103-PA 284 GF24103-PA 6..277 4..277 697 46.4 Plus
Dana\GF24104-PA 284 GF24104-PA 6..277 4..277 619 43.1 Plus
Dana\GF10177-PA 277 GF10177-PA 2..263 3..268 406 35.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15937-PA 284 GG15937-PA 1..284 1..284 1473 96.5 Plus
Dere\GG15939-PA 288 GG15939-PA 6..284 5..284 1184 77.5 Plus
Dere\GG15938-PA 284 GG15938-PA 4..277 2..277 687 44.9 Plus
Dere\GG13252-PA 278 GG13252-PA 43..264 46..268 416 39 Plus
Dere\GG13251-PA 602 GG13251-PA 283..536 13..264 381 36.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14774-PA 289 GH14774-PA 2..283 3..284 1287 85.1 Plus
Dgri\GH14776-PA 290 GH14776-PA 3..286 6..283 1133 76.1 Plus
Dgri\GH14775-PA 286 GH14775-PA 8..279 4..277 676 45.3 Plus
Dgri\GH14777-PA 286 GH14777-PA 4..281 2..279 638 45.7 Plus
Dgri\GH16522-PA 278 GH16522-PA 11..270 12..274 407 38 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG17026-PA 284 CG17026-PA 1..284 1..284 1492 100 Plus
CG17027-PB 288 CG17027-PB 5..284 4..284 1170 77.6 Plus
CG17027-PA 288 CG17027-PA 5..284 4..284 1170 77.6 Plus
CG17029-PB 284 CG17029-PB 4..277 2..277 675 45.3 Plus
CG17029-PA 284 CG17029-PA 4..277 2..277 675 45.3 Plus
CG17028-PB 284 CG17028-PB 7..277 5..277 638 44.3 Plus
CG17028-PA 284 CG17028-PA 7..277 5..277 638 44.3 Plus
CG9391-PC 278 CG9391-PC 43..268 46..272 410 39.9 Plus
CG9391-PA 278 CG9391-PA 43..268 46..272 410 39.9 Plus
CG9389-PA 596 CG9389-PA 312..540 46..274 382 36.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11876-PA 287 GI11876-PA 1..284 1..284 1326 86.6 Plus
Dmoj\GI11878-PA 282 GI11878-PA 3..279 6..283 1179 79.5 Plus
Dmoj\GI11877-PA 283 GI11877-PA 3..276 2..277 675 45.3 Plus
Dmoj\GI11880-PA 284 GI11880-PA 7..279 5..279 654 46.2 Plus
Dmoj\GI12203-PA 278 GI12203-PA 11..270 12..274 419 35.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12743-PA 287 GL12743-PA 1..283 1..283 1396 91.9 Plus
Dper\GL12746-PA 284 GL12746-PA 11..279 14..283 1170 79.6 Plus
Dper\GL12745-PA 286 GL12745-PA 7..279 4..277 615 41.8 Plus
Dper\GL12744-PA 258 GL12744-PA 7..253 4..279 611 43.5 Plus
Dper\GL24596-PA 278 GL24596-PA 7..270 8..274 418 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14278-PA 287 GA14278-PA 1..283 1..283 1405 91.9 Plus
Dpse\GA14279-PA 292 GA14279-PA 13..287 8..283 1199 79.3 Plus
Dpse\GA14281-PA 285 GA14281-PA 7..280 4..279 710 47.1 Plus
Dpse\GA28212-PA 286 GA28212-PA 7..279 4..277 618 42.2 Plus
Dpse\GA23361-PA 278 GA23361-PA 7..270 8..274 437 36.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25567-PA 284 GM25567-PA 1..284 1..284 1504 99.3 Plus
Dsec\GM25570-PA 288 GM25570-PA 6..283 5..283 1181 77.1 Plus
Dsec\GM25568-PA 284 GM25568-PA 4..277 2..277 681 44.9 Plus
Dsec\GM25569-PA 284 GM25569-PA 6..277 4..277 670 45.6 Plus
Dsec\GM22155-PA 592 GM22155-PA 308..536 46..274 383 36.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14582-PA 284 GD14582-PA 1..284 1..284 1509 99.6 Plus
Dsim\GD14585-PA 288 GD14585-PA 6..283 5..283 1189 77.8 Plus
Dsim\GD14583-PA 284 GD14583-PA 4..277 2..277 681 44.9 Plus
Dsim\GD14584-PA 284 GD14584-PA 6..277 4..277 674 45.6 Plus
Dsim\GD12132-PA 278 GD12132-PA 43..268 46..272 391 39.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13572-PA 282 GJ13572-PA 3..279 8..284 1304 87.4 Plus
Dvir\GJ13574-PA 356 GJ13574-PA 3..269 6..273 1160 79.9 Plus
Dvir\GJ13573-PA 285 GJ13573-PA 7..278 4..277 654 43.1 Plus
Dvir\GJ11436-PA 278 GJ11436-PA 2..270 3..274 415 37 Plus
Dvir\GJ11435-PA 616 GJ11435-PA 307..549 8..252 412 37.6 Plus
Dvir\GJ13574-PA 356 GJ13574-PA 266..351 192..279 216 52.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24463-PA 284 GK24463-PA 2..284 3..284 1225 79.9 Plus
Dwil\GK24484-PA 290 GK24484-PA 1..283 1..284 1149 74.6 Plus
Dwil\GK24473-PA 281 GK24473-PA 2..274 3..277 669 44.7 Plus
Dwil\GK17369-PA 279 GK17369-PA 1..271 1..274 440 37.1 Plus
Dwil\GK20398-PA 704 GK20398-PA 331..607 13..281 392 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22871-PA 284 GE22871-PA 1..284 1..284 1485 97.2 Plus
Dyak\GE22875-PA 284 GE22875-PA 1..284 1..284 1479 97.2 Plus
Dyak\GE22878-PA 288 GE22878-PA 6..284 5..284 1179 77.1 Plus
Dyak\GE22874-PA 288 GE22874-PA 6..284 5..284 1172 76.8 Plus
Dyak\GE22872-PA 284 GE22872-PA 4..277 2..277 685 45.3 Plus

IP09635.hyp Sequence

Translation from 76 to 930

> IP09635.hyp
MAASKSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTA
YDNQIEEFLVEKILARYPDHKFIGEEDTHKNDNVTKELTDAPTWIIDPID
GTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLYTAKLGQGAFCNG
KPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLAYS
AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFD
IMKPDLICAGTETLRAEIEHLIRKADQEKHVGGE*

IP09635.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17026-PA 284 CG17026-PA 1..284 1..284 1492 100 Plus
CG17027-PB 288 CG17027-PB 5..284 4..284 1170 77.6 Plus
CG17027-PA 288 CG17027-PA 5..284 4..284 1170 77.6 Plus
CG17029-PB 284 CG17029-PB 4..277 2..277 675 45.3 Plus
CG17029-PA 284 CG17029-PA 4..277 2..277 675 45.3 Plus