Clone IP09642 Report

Search the DGRC for IP09642

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:96
Well:42
Vector:pOT2
Associated Gene/TranscriptCG17571-RA
Protein status:IP09642.pep: gold
Preliminary Size:884
Sequenced Size:972

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17571 2008-04-29 Release 5.5 accounting
CG17571 2008-08-15 Release 5.9 accounting
CG17571 2008-12-18 5.12 accounting

Clone Sequence Records

IP09642.complete Sequence

972 bp (972 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024344

> IP09642.complete
TGAGAATGAATCGTTTGCTATTGAGTGTGGTGGCGCTGGTCGCCCTGGCT
GCTTCCTGCCATGGAAATCCGGGACTGGACTTCCCCTTCGGTCGGATTGT
GAACGGCGAGGACGTGGATATCGAAAACTACCCCTACCAGGTGTCCGTCC
AGACGACCAAGGGCTCCCACTTCTGTGGCGGAAGTCTGATCGATTCGGAG
ACCGTCCTGACCGCCGCCCATTGCATGCAATCCTACGCCGCCAGCGAGCT
GCAGGTGCGAGTGGGTTCCACTTCCAGGAGCTCCGGTGGTGAGGTGGTCA
CCGTCCGCGCCTTCAAGTACCACGAGGGCTACAACAGCAAGTTGATGATC
AACGATGTGGCCATCATCAAGCTGAGCTCTCCCGTTCGCCAGACCTCTAA
GATCCGGGCCATCGAACTGGCCGACTCCGAGGCCGTTTCCGGAACCAATG
CCGTGGTCTCCGGCTGGGGCACCACCTGCTTCCTTTTCTGCTCCTCCCCC
GACACCCTTCAGAAGGTGGAGGTTGATCTGCTGCACTACAAGGACTGTGC
CGCCGACACGTACAACTACGGCAGCGACTCGATTCTGGAGACCATGGTCT
GTGCCACCGGCGAGAAGAAGGACGCCTGCCAGGGTGACTCCGGTGGTCCT
TTGGTCGCGGACAACAAGCTTGTGGGCGTGGTTTCCTGGGGCAGCGGATG
TGCCTGGACCGGCTACCCCGGCGTCTATGCCGATGTCGCCAGCCTGAGGA
GCTGGATCGTTGACACCACTGACTCGTTGTAAATGGAAATAATATAATAT
AATGCAAGAGTATTTCAAGACATTTGTGTATAAGCATACATTGCGTTGAT
GCTTTAATTTCCTAGCTGCTTAAATGGGTACTGGGTACACCACAAGTCCT
GGTAAACAATACTTTATTTTAAATAGAATCAATCGATTTCTTAAAACCAA
AAAAAAAAAAAAAAAAAAAAAA

IP09642.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17571-RA 1048 CG17571-RA 101..1048 1..948 4740 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20254404..20255351 948..1 4725 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:58:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20255987..20256935 949..1 4745 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20255987..20256935 949..1 4745 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:11:54 has no hits.

IP09642.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:12:53 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20254404..20255351 1..948 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:41:16 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 1..777 6..782 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:31 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 1..777 6..782 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:38:55 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 1..777 6..782 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:25 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 1..777 6..782 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:54:10 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 1..777 6..782 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:18 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 101..1048 1..948 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:31 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 101..1048 1..948 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:38:55 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 18..965 1..948 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:26 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 101..1048 1..948 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:54:10 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
CG17571-RA 18..965 1..948 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:53 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20255988..20256935 1..948 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:53 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20255988..20256935 1..948 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:53 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20255988..20256935 1..948 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:38:55 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20255988..20256935 1..948 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:00:42 Download gff for IP09642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20255988..20256935 1..948 100   Minus

IP09642.hyp Sequence

Translation from 2 to 781

> IP09642.hyp
RMNRLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQ
TTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVT
VRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNA
VVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVC
ATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRS
WIVDTTDSL*

IP09642.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17571-PB 258 CG17571-PB 1..258 2..259 1345 100 Plus
CG17571-PA 258 CG17571-PA 1..258 2..259 1345 100 Plus
thetaTry-PA 262 CG12385-PA 1..262 2..259 666 51.9 Plus
alphaTry-PA 256 CG18444-PA 1..256 5..259 644 51.3 Plus
CG30025-PA 253 CG30025-PA 1..251 5..254 634 50.8 Plus

IP09642.pep Sequence

Translation from 5 to 781

> IP09642.pep
MNRLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQT
TKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTV
RAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAV
VSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCA
TGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSW
IVDTTDSL*

IP09642.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15448-PA 257 GF15448-PA 1..257 1..258 1029 77.1 Plus
Dana\GF12404-PA 262 GF12404-PA 28..262 27..258 647 53.4 Plus
Dana\GF12402-PA 256 GF12402-PA 6..252 4..254 626 52.2 Plus
Dana\GF12546-PA 256 GF12546-PA 1..256 4..258 591 50.2 Plus
Dana\GF12403-PA 256 GF12403-PA 1..256 4..258 572 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21582-PA 258 GG21582-PA 1..258 1..258 1256 90.7 Plus
Dere\thetaTry-PA 262 GG22662-PA 28..262 27..258 650 53.8 Plus
Dere\epsilonTry-PA 256 GG22660-PA 6..252 4..254 596 50.2 Plus
Dere\alphaTry-PA 256 GG22661-PA 25..256 22..258 572 53.6 Plus
Dere\betaTry-PA 253 GG20194-PA 1..251 4..253 563 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10777-PA 258 GH10777-PA 1..258 1..258 899 64.7 Plus
Dgri\GH22926-PA 256 GH22926-PA 6..256 4..258 628 52.7 Plus
Dgri\GH22866-PA 255 GH22866-PA 1..255 5..258 623 49.4 Plus
Dgri\GH22924-PA 256 GH22924-PA 6..256 4..258 617 51.2 Plus
Dgri\GH22925-PA 254 GH22925-PA 6..254 4..256 607 52 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17571-PB 258 CG17571-PB 1..258 1..258 1345 100 Plus
CG17571-PA 258 CG17571-PA 1..258 1..258 1345 100 Plus
thetaTry-PA 262 CG12385-PA 1..262 1..258 666 51.9 Plus
alphaTry-PA 256 CG18444-PA 1..256 4..258 644 51.3 Plus
CG30025-PA 253 CG30025-PA 1..251 4..253 634 50.8 Plus
gammaTry-PA 253 CG30028-PA 1..250 4..252 633 51 Plus
deltaTry-PA 253 CG12351-PA 1..250 4..252 633 51 Plus
CG30031-PA 253 CG30031-PA 1..250 4..252 633 51 Plus
epsilonTry-PA 256 CG18681-PA 6..256 4..258 614 51 Plus
betaTry-PB 253 CG18211-PB 1..251 4..253 596 48 Plus
betaTry-PA 253 CG18211-PA 1..251 4..253 596 48 Plus
Ser8-PA 260 CG4812-PA 1..254 1..252 525 45.1 Plus
iotaTry-PA 252 CG7754-PA 26..252 29..258 508 43 Plus
CG31954-PA 277 CG31954-PA 44..271 21..251 423 41.1 Plus
CG17239-PB 248 CG17239-PB 23..244 30..258 418 41 Plus
CG17239-PA 248 CG17239-PA 23..244 30..258 418 41 Plus
Ser12-PA 245 CG17240-PA 23..245 30..258 414 39.6 Plus
CG31681-PA 264 CG31681-PA 4..249 3..251 410 40 Plus
CG11192-PB 279 CG11192-PB 5..265 3..257 408 39 Plus
zetaTry-PA 280 CG12387-PA 9..273 4..251 407 41.2 Plus
etaTry-PA 262 CG12386-PA 1..254 1..251 400 39.8 Plus
Try29F-PD 267 CG9564-PD 36..261 22..251 400 41.9 Plus
Try29F-PC 267 CG9564-PC 36..261 22..251 400 41.9 Plus
CG7829-PA 253 CG7829-PA 24..245 27..251 392 39.6 Plus
CG8299-PA 260 CG8299-PA 28..258 31..257 386 38.8 Plus
CG32269-PB 332 CG32269-PB 108..324 30..250 379 38.3 Plus
CG32269-PA 332 CG32269-PA 108..324 30..250 379 38.3 Plus
lambdaTry-PA 272 CG12350-PA 1..259 1..254 377 36.6 Plus
Send1-PA 255 CG17012-PA 8..246 4..258 373 37.6 Plus
Send2-PA 239 CG18125-PA 23..232 27..258 371 38.2 Plus
CG13430-PB 267 CG13430-PB 30..266 29..258 371 37.9 Plus
CG13430-PA 267 CG13430-PA 30..266 29..258 371 37.9 Plus
CG17234-PA 251 CG17234-PA 26..250 30..258 360 38.7 Plus
CG10405-PB 268 CG10405-PB 33..262 27..251 360 38 Plus
CG34458-PA 257 CG34458-PA 31..251 30..251 358 37.9 Plus
CG16749-PA 265 CG16749-PA 7..257 4..251 354 34.4 Plus
CG32271-PA 248 CG32271-PA 24..242 30..251 353 38.6 Plus
CG17475-PB 288 CG17475-PB 43..267 23..251 353 36.2 Plus
CG17475-PA 288 CG17475-PA 43..267 23..251 353 36.2 Plus
CG3355-PA 314 CG3355-PA 75..306 30..255 349 40.6 Plus
CG18735-PA 364 CG18735-PA 82..315 30..255 348 35 Plus
CG4386-PA 372 CG4386-PA 126..358 30..255 348 34.6 Plus
l(2)k05911-PC 639 CG31728-PC 399..634 30..251 347 37.8 Plus
CG32834-PB 556 CG32834-PB 26..257 30..256 346 37 Plus
CG32270-PA 259 CG32270-PA 30..253 30..253 343 40.4 Plus
CG3650-PA 249 CG3650-PA 48..244 53..252 341 39.5 Plus
CG31269-PB 273 CG31269-PB 12..255 5..251 338 32.8 Plus
CG31265-PA 266 CG31265-PA 35..254 29..251 336 34.1 Plus
kappaTry-PC 263 CG12388-PC 22..256 27..254 333 34.7 Plus
CG17242-PA 245 CG17242-PA 20..235 35..254 327 38 Plus
CG17242-PB 245 CG17242-PB 20..235 35..254 327 38 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17438-PA 258 GI17438-PA 1..258 1..258 928 65.5 Plus
Dmoj\GI17437-PA 238 GI17437-PA 2..238 22..258 875 67.1 Plus
Dmoj\GI21243-PA 255 GI21243-PA 1..255 5..258 658 53.3 Plus
Dmoj\GI21245-PA 261 GI21245-PA 7..261 4..258 652 50.4 Plus
Dmoj\GI21244-PA 256 GI21244-PA 6..256 4..258 543 51.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26041-PA 259 GL26041-PA 1..259 1..258 1007 72.3 Plus
Dper\GL17340-PA 261 GL17340-PA 4..261 5..258 671 52.1 Plus
Dper\GL17339-PA 256 GL17339-PA 1..256 4..258 622 51.3 Plus
Dper\GL17338-PA 256 GL17338-PA 1..256 4..258 617 51 Plus
Dper\GL17143-PA 256 GL17143-PA 1..256 4..258 611 52.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23343-PA 259 GA23343-PA 1..259 1..258 1006 72.3 Plus
Dpse\GA11597-PA 261 GA11597-PA 4..261 5..258 671 52.1 Plus
Dpse\GA15051-PA 256 GA15051-PA 1..256 4..258 630 51.3 Plus
Dpse\GA14937-PA 256 GA14937-PA 1..256 4..258 622 51.3 Plus
Dpse\GA24980-PA 256 GA24980-PA 1..256 4..258 610 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23335-PA 200 GM23335-PA 17..195 24..204 850 90.1 Plus
Dsec\GM20441-PA 256 GM20441-PA 25..256 22..258 563 53.6 Plus
Dsec\GM21468-PA 260 GM21468-PA 34..260 30..258 509 45.2 Plus
Dsec\GM21283-PA 266 GM21283-PA 25..266 22..258 472 41.5 Plus
Dsec\GM18246-PA 248 GM18246-PA 23..244 30..258 444 41 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21711-PA 258 GD21711-PA 1..258 1..258 1314 95.3 Plus
Dsim\GD25908-PA 262 GD25908-PA 14..262 15..258 661 53.6 Plus
Dsim\GD15391-PA 253 GD15391-PA 1..251 4..253 580 50.8 Plus
Dsim\GD25907-PA 485 GD25907-PA 254..485 22..258 547 53.2 Plus
Dsim\GD25907-PA 485 GD25907-PA 6..230 4..232 544 50.6 Plus
Dsim\GD15412-PA 260 GD15412-PA 34..260 30..258 519 46.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18385-PA 258 GJ18385-PA 1..258 1..258 1028 72.9 Plus
Dvir\GJ20850-PA 261 GJ20850-PA 4..261 1..258 658 51.1 Plus
Dvir\GJ21497-PA 309 GJ21497-PA 82..309 29..258 584 53.5 Plus
Dvir\Try1-PA 256 GJ21500-PA 6..256 4..258 581 52.7 Plus
Dvir\GJ21499-PA 256 GJ21499-PA 6..256 4..258 581 52.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24139-PA 259 GK24139-PA 1..256 1..258 1004 72.1 Plus
Dwil\GK24137-PA 259 GK24137-PA 1..257 1..258 972 69 Plus
Dwil\GK19331-PA 263 GK19331-PA 28..262 27..258 661 54.7 Plus
Dwil\GK21994-PA 256 GK21994-PA 1..256 5..258 647 51.7 Plus
Dwil\GK21995-PA 256 GK21995-PA 6..256 4..258 636 55.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12601-PA 258 GE12601-PA 1..258 1..258 1205 91.1 Plus
Dyak\GE13536-PA 262 GE13536-PA 28..262 27..258 642 54.2 Plus
Dyak\epsilonTry-PA 256 GE13534-PA 1..256 4..258 614 49.4 Plus
Dyak\GE13533-PA 256 GE13533-PA 1..256 4..258 609 52.1 Plus
Dyak\GE12354-PA 256 GE12354-PA 1..256 4..258 609 52.1 Plus