Clone IP09702 Report

Search the DGRC for IP09702

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:97
Well:2
Vector:pOT2
Associated Gene/TranscriptCG15155-RA
Protein status:IP09702.pep:
Preliminary Size:777
Sequenced Size:911

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15155 2008-04-29 Release 5.5 accounting
CG15155 2008-08-15 Release 5.9 accounting
CG15155 2008-12-18 5.12 accounting

Clone Sequence Records

IP09702.complete Sequence

911 bp (911 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023561

> IP09702.complete
GATCGTCTGCAGCAGGTCGGCGTTCAGCAGTTGGGTGATCTGAAGCGTGT
TTTCACCCGGGAATGGCCAAAATACTGCAAGGAGTACTACTGCCTGGACA
CGTTTCTGGAGCTATATAAAAAGGACGATCAGCTGAAGGATGTGCAAGTC
TATGCTCTTCCCAATCTAGAGCTCGGAATATTTGTGATCGTGGATCACTA
TCAGATATTTGTGGGCTTCCTGGAAGCTGAACAATCAGAAAGCCTTTTCA
AGGAGTCCTTACTCAAGTTTAAGCTCTATGGAGGCGAACAGTTCGCCTCA
ATGCCAAAAAGGTATTTCAATGTTGCCAACGACATTATTCAAGCGAAGAA
TCTGAAACTAGATCTCGACTGTGTAACACTTTCCCTGGTCTTGAGCAAAG
AGGAAGCCCTGCTTTTTCAAGTAGAACCTCCAGCCGGATTTTCCCTTAAG
CCGGTAGATATAGACGATGCTCAGGTGATTAATGATCAATGGGAATGGAG
TGAGCCGGATTCCCTTTCCGTGGTCCGCCGTCAAATTCTGGCTCCAGATG
GCTTATTGGCAGTCCTTCAGGTCAAGACGACCTACAAACGCAGAGGCTTC
GGCCAACTGATTGTGAAGGAATTTGCGAGACAAGAGGCTCTGCTGGGACG
CGATACAATCACCGAAGTGGTTCCGGAAAACAAGGCATCCTTGGGCCTGT
TCACCAAACTGGGCTTTAAAATCAACGACCAGTGTCACTGGCTGATGACG
GAGCCGCCAAAAGGAGTTCGATAAGATTAAGGACTTGTTTATCTGTAAAT
GTTATTTTTTTTGTAGATTTAAATTATTAAAGCTGATAAGTTTTAGCAGC
TGGCAAAAAATGTACTGGCTGGCCATAAGAAAACCACACGTAAAAAAAAA
AAAAAAAAAAA

IP09702.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG15155-RA 1142 CG15155-RA 181..1073 1..893 4465 100 Plus
CG15155.b 895 CG15155.b 6..895 1..893 4395 99.6 Plus
CG15155.a 960 CG15155.a 6..545 1..540 2700 100 Plus
CG15155.a 960 CG15155.a 607..960 540..893 1770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18154239..18154590 540..891 1745 99.7 Plus
chr2L 23010047 chr2L 18153767..18154000 192..425 1170 100 Plus
chr2L 23010047 chr2L 18153517..18153709 1..193 965 100 Plus
chr2L 23010047 chr2L 18154063..18154177 426..540 575 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18155591..18155944 540..893 1770 100 Plus
2L 23513712 2L 18155119..18155352 192..425 1170 100 Plus
2L 23513712 2L 18154869..18155061 1..193 965 100 Plus
2L 23513712 2L 18155415..18155529 426..540 575 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18155591..18155944 540..893 1770 100 Plus
2L 23513712 2L 18155119..18155352 192..425 1170 100 Plus
2L 23513712 2L 18154869..18155061 1..193 965 100 Plus
2L 23513712 2L 18155415..18155529 426..540 575 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:30:17 has no hits.

IP09702.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:30:58 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18153517..18153708 1..192 100 -> Plus
chr2L 18153768..18154000 193..425 100 -> Plus
chr2L 18154063..18154176 426..539 100 -> Plus
chr2L 18154239..18154590 540..891 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:41:45 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 4..777 1..774 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:42 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 4..777 1..774 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:30:59 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 4..777 1..774 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:15 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 4..777 1..774 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:30 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 4..777 1..774 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:43:44 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 6..896 1..891 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:42 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 6..896 1..891 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:30:59 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 19..909 1..891 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:15 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 6..896 1..891 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:30 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15155-RA 19..909 1..891 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:58 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18154869..18155060 1..192 100 -> Plus
2L 18155120..18155352 193..425 100 -> Plus
2L 18155415..18155528 426..539 100 -> Plus
2L 18155591..18155942 540..891 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:58 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18154869..18155060 1..192 100 -> Plus
2L 18155120..18155352 193..425 100 -> Plus
2L 18155415..18155528 426..539 100 -> Plus
2L 18155591..18155942 540..891 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:58 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18154869..18155060 1..192 100 -> Plus
2L 18155120..18155352 193..425 100 -> Plus
2L 18155415..18155528 426..539 100 -> Plus
2L 18155591..18155942 540..891 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:30:59 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18154869..18155060 1..192 100 -> Plus
arm_2L 18155120..18155352 193..425 100 -> Plus
arm_2L 18155415..18155528 426..539 100 -> Plus
arm_2L 18155591..18155942 540..891 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:11 Download gff for IP09702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18155120..18155352 193..425 100 -> Plus
2L 18155415..18155528 426..539 100 -> Plus
2L 18155591..18155942 540..891 100   Plus
2L 18154869..18155060 1..192 100 -> Plus

IP09702.pep Sequence

Translation from 0 to 773

> IP09702.pep
DRLQQVGVQQLGDLKRVFTREWPKYCKEYYCLDTFLELYKKDDQLKDVQV
YALPNLELGIFVIVDHYQIFVGFLEAEQSESLFKESLLKFKLYGGEQFAS
MPKRYFNVANDIIQAKNLKLDLDCVTLSLVLSKEEALLFQVEPPAGFSLK
PVDIDDAQVINDQWEWSEPDSLSVVRRQILAPDGLLAVLQVKTTYKRRGF
GQLIVKEFARQEALLGRDTITEVVPENKASLGLFTKLGFKINDQCHWLMT
EPPKGVR*

IP09702.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14491-PA 271 GF14491-PA 4..263 3..255 738 54.2 Plus
Dana\GF14492-PA 284 GF14492-PA 2..276 2..255 452 35.6 Plus
Dana\GF14490-PA 293 GF14490-PA 11..281 6..252 221 23.1 Plus
Dana\GF15332-PA 277 GF15332-PA 139..275 131..247 175 32.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21111-PA 257 GG21111-PA 2..256 1..255 1168 85.1 Plus
Dere\GG21112-PA 287 GG21112-PA 4..279 2..255 480 36.6 Plus
Dere\GG21109-PA 293 GG21109-PA 13..284 8..255 250 26.3 Plus
Dere\GG23486-PA 281 GG23486-PA 141..277 132..248 180 32.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11205-PA 288 GH11205-PA 5..280 3..255 480 37.4 Plus
Dgri\GH11204-PA 290 GH11204-PA 6..282 2..255 417 36.2 Plus
Dgri\GH11202-PA 292 GH11202-PA 14..280 11..252 245 26.9 Plus
Dgri\GH11464-PA 279 GH11464-PA 142..277 132..247 205 36 Plus
Dgri\GH11463-PA 280 GH11463-PA 142..277 132..247 201 36 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15155-PA 258 CG15155-PA 2..258 1..257 1332 100 Plus
CG15155-PB 257 CG15155-PB 2..257 1..257 1316 99.6 Plus
CG5783-PA 287 CG5783-PA 4..279 2..255 467 36.2 Plus
CG17681-PA 293 CG17681-PA 13..284 8..255 253 25.2 Plus
CG12560-PB 278 CG12560-PB 135..276 126..247 192 32.4 Plus
CG12560-PC 272 CG12560-PC 152..270 149..247 160 31.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18126-PA 285 GI18126-PA 2..277 2..255 465 37.8 Plus
Dmoj\GI18127-PA 287 GI18127-PA 5..279 3..255 447 35 Plus
Dmoj\GI18125-PA 292 GI18125-PA 9..283 6..255 222 24.6 Plus
Dmoj\GI16891-PA 265 GI16891-PA 137..263 141..247 157 30.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18696-PA 286 GL18696-PA 4..278 3..255 518 41.5 Plus
Dper\GL18697-PA 287 GL18697-PA 4..279 2..255 468 35.3 Plus
Dper\GL18695-PA 293 GL18695-PA 13..284 8..255 247 25.2 Plus
Dper\GL18506-PA 274 GL18506-PA 137..272 132..247 185 32.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25759-PA 285 GA25759-PA 4..277 3..255 581 44.5 Plus
Dpse\GA19124-PA 287 GA19124-PA 4..279 2..255 457 34.9 Plus
Dpse\GA14610-PA 293 GA14610-PA 13..284 8..255 248 25.5 Plus
Dpse\GA25663-PA 286 GA25663-PA 161..284 144..247 165 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17268-PA 258 GM17268-PA 2..258 1..257 1299 96.5 Plus
Dsec\GM17269-PA 287 GM17269-PA 4..279 2..255 477 36.2 Plus
Dsec\GM17267-PA 291 GM17267-PA 10..282 7..255 266 25.5 Plus
Dsec\GM13211-PA 277 GM13211-PA 135..275 126..247 175 31.2 Plus
Dsec\GM13208-PA 161 GM13208-PA 42..154 155..247 149 28.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24133-PA 250 GD24133-PA 2..250 1..257 1126 86 Plus
Dsim\GD24134-PA 287 GD24134-PA 4..279 2..255 477 36.2 Plus
Dsim\GD24132-PA 395 GD24132-PA 11..280 6..251 241 24.3 Plus
Dsim\GD22448-PA 278 GD22448-PA 135..276 126..247 182 31.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17752-PA 287 GJ17752-PA 20..279 18..255 471 37.8 Plus
Dvir\GJ17751-PA 285 GJ17751-PA 2..277 2..255 454 37.5 Plus
Dvir\GJ17749-PA 292 GJ17749-PA 11..283 8..255 211 24.8 Plus
Dvir\GJ17205-PA 281 GJ17205-PA 144..279 132..247 174 30.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15540-PA 235 GK15540-PA 4..233 3..231 496 41.7 Plus
Dwil\GK15541-PA 288 GK15541-PA 5..280 3..255 489 38.6 Plus
Dwil\GK15539-PA 289 GK15539-PA 6..277 2..252 251 25.9 Plus
Dwil\GK15128-PA 339 GK15128-PA 212..335 144..247 160 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13183-PA 279 GE13183-PA 2..277 1..255 1186 81.9 Plus
Dyak\GE13184-PA 287 GE13184-PA 4..279 2..255 470 35.6 Plus
Dyak\GE13182-PA 293 GE13182-PA 13..284 8..255 285 26.6 Plus
Dyak\GE11237-PA 278 GE11237-PA 141..276 132..247 202 35.3 Plus
Dyak\GE11235-PA 264 GE11235-PA 127..262 132..247 151 31.6 Plus

IP09702.hyp Sequence

Translation from 0 to 773

> IP09702.hyp
DRLQQVGVQQLGDLKRVFTREWPKYCKEYYCLDTFLELYKKDDQLKDVQV
YALPNLELGIFVIVDHYQIFVGFLEAEQSESLFKESLLKFKLYGGEQFAS
MPKRYFNVANDIIQAKNLKLDLDCVTLSLVLSKEEALLFQVEPPAGFSLK
PVDIDDAQVINDQWEWSEPDSLSVVRRQILAPDGLLAVLQVKTTYKRRGF
GQLIVKEFARQEALLGRDTITEVVPENKASLGLFTKLGFKINDQCHWLMT
EPPKGVR*

IP09702.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15155-PA 258 CG15155-PA 2..258 1..257 1332 100 Plus
CG15155-PB 257 CG15155-PB 2..257 1..257 1316 99.6 Plus
CG5783-PA 287 CG5783-PA 4..279 2..255 467 36.2 Plus
CG17681-PA 293 CG17681-PA 13..284 8..255 253 25.2 Plus
CG12560-PB 278 CG12560-PB 135..276 126..247 192 32.4 Plus