Clone IP09718 Report

Search the DGRC for IP09718

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:97
Well:18
Vector:pOT2
Associated Gene/TranscriptCG15601-RA
Protein status:IP09718.pep: gold
Preliminary Size:834
Sequenced Size:1059

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15601 2008-04-29 Release 5.5 accounting
CG15601 2008-08-15 Release 5.9 accounting
CG15601 2008-12-18 5.12 accounting

Clone Sequence Records

IP09718.complete Sequence

1059 bp (1059 high quality bases) assembled on 2006-04-14

GenBank Submission: BT025115

> IP09718.complete
TTTTCCTTTGGTCCAAAAAGGAATTGGTCATGTCGAAGTTGAGCGACACT
AAGATCCCGATCACGGAGTTCCTGGAGGCATACCGTCGCCAGCCGTGCCT
CTACAACACACTGCTGGACTCGTACAAGAATCGTGTGTCCCGGGAGGAGG
CCTACGGAGCGATCATCCGGTCCCTGAAGATACCCCAACTGACAGTGTCG
GACATAAAGCTAAAGATCAAGAGCGTGCGTACCGTGTACTCTAAGGAGCT
GCGCATCTGGATGCGTGAGAAGGAGCTGGGCAGGACCTACGAACCAAAGT
TGTTTTGGTTTAGGTTGGCCGACTCCTTTCTACGCTCCGTTTCCCTCTCC
CACTGCAAAAGGCAGGGAAAAAATAACAGTTCCAGTGCTCAATTAACGAC
GATCAAATCGGATGAGACGAGCAAGCTTCTTTGCACTGCCGCCGCAGATA
TCACTATGAGCGAGGATGCGCTAGAGGAAGAGGATGCAGAGGTAAATGGC
GAGCCGGAGGAGTGTCCTTTGGAGGAAAGCAGGCCAACAGCAAGCATCTG
CAAAGATGATTCCACGCTCTGCCTGGCGGATCAACCACAGCAGGAGCACT
ATTCTCAGGGGTGCAGCAGCTCCCAGCAGCTTCCTCACACGATGGCACAA
CGAAAATCAAAGTACATTACAAGTCTGGACTCGGCCGGAGAGGATGATCT
TATTATATTCGGCCAGAGCATCGCCTCTCAGCTGCGAACCATTCCGGATT
CATATTCTCGGTCCGTGGCTAAGCTGCGTATCCAGCAGGTGCTGTTCGAG
GCTGAAACCGGGCAGTTTCAGAGCACCGAGGTCAATAGCACGCAACTCCA
GAATACCTTTTAAACCATAAGTCTAAATTTAAACACTGTGCTCAGTTCTG
GCAAAATCCCCAAAAATATGCCACCCTGGCCTAATTTCCAGGGGATATTT
ATCAACCCGTTTGCCATTCAGTATATGTAGTCAAGCTAGTTCTAAGGATT
GACGGTTAAGTATAAAATGTAAATAAAAATGCTATCAAGTAAAAAAAAAA
AAAAAAAAA

IP09718.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15601-RA 1412 CG15601-RA 249..1290 1..1042 5210 100 Plus
CG15601.c 1409 CG15601.c 249..1287 1..1042 5140 99.7 Plus
CG15601.a 980 CG15601.a 296..980 356..1040 3395 99.7 Plus
CG15601.a 980 CG15601.a 79..302 1..224 1120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15601338..15602016 362..1040 3395 100 Plus
chrX 22417052 chrX 15600925..15601286 1..362 1810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15711508..15712188 362..1042 3405 100 Plus
X 23542271 X 15711095..15711456 1..362 1810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15719606..15720286 362..1042 3405 100 Plus
X 23527363 X 15719193..15719554 1..362 1810 100 Plus
Blast to na_te.dros performed 2019-03-16 23:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 138..196 354..417 109 70.3 Plus

IP09718.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:46:20 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15600925..15601286 1..362 100 -> Plus
chrX 15601339..15602016 363..1040 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:42:05 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..834 30..863 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:47 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..834 30..863 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:17 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..834 30..863 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:30 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..834 30..863 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:59 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..834 30..863 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:24:29 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..834 30..863 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:47 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..1040 1..1040 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:17 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 39..1078 1..1040 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:31 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 1..834 30..863 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:59 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
CG15601-RA 39..1078 1..1040 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:20 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
X 15711095..15711456 1..362 100 -> Plus
X 15711509..15712186 363..1040 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:20 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
X 15711095..15711456 1..362 100 -> Plus
X 15711509..15712186 363..1040 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:20 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
X 15711095..15711456 1..362 100 -> Plus
X 15711509..15712186 363..1040 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:17 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15605128..15605489 1..362 100 -> Plus
arm_X 15605542..15606219 363..1040 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:59 Download gff for IP09718.complete
Subject Subject Range Query Range Percent Splice Strand
X 15719193..15719554 1..362 100 -> Plus
X 15719607..15720284 363..1040 100   Plus

IP09718.hyp Sequence

Translation from 2 to 862

> IP09718.hyp
FLWSKKELVMSKLSDTKIPITEFLEAYRRQPCLYNTLLDSYKNRVSREEA
YGAIIRSLKIPQLTVSDIKLKIKSVRTVYSKELRIWMREKELGRTYEPKL
FWFRLADSFLRSVSLSHCKRQGKNNSSSAQLTTIKSDETSKLLCTAAADI
TMSEDALEEEDAEVNGEPEECPLEESRPTASICKDDSTLCLADQPQQEHY
SQGCSSSQQLPHTMAQRKSKYITSLDSAGEDDLIIFGQSIASQLRTIPDS
YSRSVAKLRIQQVLFEAETGQFQSTEVNSTQLQNTF*

IP09718.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15601-PA 277 CG15601-PA 1..277 10..286 1404 100 Plus
CG15601-PB 276 CG15601-PB 1..276 10..286 1387 99.6 Plus
CG15601-PC 231 CG15601-PC 1..231 10..286 1103 83.4 Plus
CG15601-PD 230 CG15601-PD 1..230 10..286 1097 83 Plus

IP09718.pep Sequence

Translation from 29 to 862

> IP09718.pep
MSKLSDTKIPITEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLK
IPQLTVSDIKLKIKSVRTVYSKELRIWMREKELGRTYEPKLFWFRLADSF
LRSVSLSHCKRQGKNNSSSAQLTTIKSDETSKLLCTAAADITMSEDALEE
EDAEVNGEPEECPLEESRPTASICKDDSTLCLADQPQQEHYSQGCSSSQQ
LPHTMAQRKSKYITSLDSAGEDDLIIFGQSIASQLRTIPDSYSRSVAKLR
IQQVLFEAETGQFQSTEVNSTQLQNTF*

IP09718.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21922-PA 315 GF21922-PA 1..315 1..277 811 58.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17900-PA 298 GG17900-PA 1..298 1..277 1169 80.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24542-PA 364 GH24542-PA 1..111 1..111 494 82 Plus
Dgri\GH24542-PA 364 GH24542-PA 311..352 221..262 206 92.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15601-PA 277 CG15601-PA 1..277 1..277 1404 100 Plus
CG15601-PB 276 CG15601-PB 1..276 1..277 1387 99.6 Plus
CG15601-PC 231 CG15601-PC 1..231 1..277 1103 83.4 Plus
CG15601-PD 230 CG15601-PD 1..230 1..277 1097 83 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16350-PA 313 GI16350-PA 1..111 1..111 513 82 Plus
Dmoj\GI16350-PA 313 GI16350-PA 256..312 218..275 197 70.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16481-PA 315 GL16481-PA 1..128 1..149 311 49.3 Plus
Dper\GL16481-PA 315 GL16481-PA 256..304 221..269 164 63.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13842-PA 325 GA13842-PA 1..137 1..149 395 55 Plus
Dpse\GA13842-PA 325 GA13842-PA 266..314 221..269 163 63.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22567-PA 274 GM22567-PA 1..274 1..277 1183 87.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17229-PA 274 GD17229-PA 1..274 1..277 1187 88.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16895-PA 363 GJ16895-PA 1..362 1..275 560 44 Plus
Dvir\GJ13325-PA 258 GJ13325-PA 1..258 1..275 144 24.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10303-PA 126 GK10303-PA 1..111 1..111 520 87.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17208-PA 297 GE17208-PA 1..297 1..277 1081 79.9 Plus