Clone IP09741 Report

Search the DGRC for IP09741

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:97
Well:41
Vector:pOT2
Associated Gene/TranscriptCG17477-RA
Protein status:IP09741.pep: gold
Preliminary Size:804
Sequenced Size:869

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17477 2005-01-01 Successful iPCR screen
CG17477 2008-04-29 Release 5.5 accounting
CG17477 2008-08-15 Release 5.9 accounting
CG17477 2008-12-18 5.12 accounting

Clone Sequence Records

IP09741.complete Sequence

869 bp (869 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024339

> IP09741.complete
TTTCAGCCATGTCGCTTGCACGTTTCCTATTTTATATTCTCGTGTTCAGT
TCACTCTACTGTGACTTATTGGCATTGGAGCACTTCATTGTGGGTGGCCA
GAATGCAGCTGAAGGAGATGCCCCCTACCAGGTGTCGCTCCAAACTCTTT
TGGGTAGTCACCTATGCGGTGGTGCCATCATATCGGACCGATGGATAATT
ACGGCTGGTCACTGTGTCAAAGGATACCCGACTAGCAGACTTCAAGTGGC
CACTGGTACAATTCGCTATGCGGAACCAGGAGCTGTTTATTACCCAGACG
CCATCTACCTGCACTGCAACTATGACAGTCCCAAGTACCAGAATGATATT
GGCCTGCTCCACCTGAACGAGAGCATTACCTTTAACGCACTAACTCAGGC
GGTTGAACTACCCACATCCCCTTTTCCAAGAGGAGCTTCGGAGCTGGTTT
TCACCGGATGGGGATCTCAGTCAGCGGCGGGGTCGTTGCCATCGCAGTTG
CAGCGTGTCCAGCAGCAACACCTCAACTCCCCGGCTTGCGAGTCCATGAT
GTCTGCCTACGAGGATCTGGAACTGGGACCTTGCCATATTTGTGCTTATC
GTCAGGCAAATATTGGAGCCTGCCACGGAGATTCTGGAGGTCCTCTAGTT
CACCAGGGCACCCTGGTGGGCATACTCAACTTCTTTGTACCCTGCGCCCA
GGGTGTGCCTGATATATTCATGAATATAATGTACTACCGCGACTGGATGC
GACAAACGATGAGTGGCAATGGCAAATGTGCACAGGTCAACCAGCAGACA
ATAGATGGATAAAAACATTTGAACTCATTAAAGAACCTCAATTCATAATG
TAAAAAAAAAAAAAAAAAA

IP09741.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG17477-RA 851 CG17477-RA 1..851 1..851 4255 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12950513..12951363 851..1 4150 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17126086..17126938 853..1 4265 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16866917..16867769 853..1 4265 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:34:36 has no hits.

IP09741.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:35:30 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12950513..12951363 1..851 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:42:19 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..804 9..812 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:33 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..804 9..812 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:40:05 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..804 9..812 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:27 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..804 9..812 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:08 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..804 9..812 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:20 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:33 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:40:05 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:28 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:08 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
CG17477-RA 1..851 1..851 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:30 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17126088..17126938 1..851 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:30 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17126088..17126938 1..851 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:30 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17126088..17126938 1..851 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:40:05 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12951810..12952660 1..851 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:00:43 Download gff for IP09741.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16866919..16867769 1..851 100   Minus

IP09741.hyp Sequence

Translation from 2 to 811

> IP09741.hyp
SAMSLARFLFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLL
GSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDA
IYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVF
TGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYR
QANIGACHGDSGGPLVHQGTLVGILNFFVPCAQGVPDIFMNIMYYRDWMR
QTMSGNGKCAQVNQQTIDG*

IP09741.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17477-PA 267 CG17477-PA 1..267 3..269 1434 100 Plus
CG17475-PB 288 CG17475-PB 50..273 29..255 602 47.1 Plus
CG17475-PA 288 CG17475-PA 50..273 29..255 602 47.1 Plus
CG31265-PA 266 CG31265-PA 37..264 29..259 598 49.4 Plus
CG31269-PB 273 CG31269-PB 38..265 29..259 590 48.1 Plus

IP09741.pep Sequence

Translation from 8 to 811

> IP09741.pep
MSLARFLFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGS
HLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIY
LHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTG
WGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQA
NIGACHGDSGGPLVHQGTLVGILNFFVPCAQGVPDIFMNIMYYRDWMRQT
MSGNGKCAQVNQQTIDG*

IP09741.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17863-PA 269 GF17863-PA 1..269 1..267 1172 79.9 Plus
Dana\GF17129-PA 274 GF17129-PA 38..266 27..258 590 47.8 Plus
Dana\GF17862-PA 288 GF17862-PA 51..280 27..261 587 47.2 Plus
Dana\GF19903-PA 267 GF19903-PA 38..265 27..257 574 45.9 Plus
Dana\GF17132-PA 272 GF17132-PA 39..270 24..256 526 42.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16791-PA 267 GG16791-PA 1..267 1..267 1233 85 Plus
Dere\GG16790-PA 288 GG16790-PA 44..273 21..253 585 45.9 Plus
Dere\GG22017-PA 273 GG22017-PA 35..266 24..258 581 47.7 Plus
Dere\GG22028-PA 266 GG22028-PA 37..264 27..257 574 47.6 Plus
Dere\GG22071-PA 273 GG22071-PA 30..254 27..252 532 47.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14253-PA 260 GH14253-PA 20..259 25..265 895 62.7 Plus
Dgri\GH14062-PA 266 GH14062-PA 16..266 1..259 597 46.7 Plus
Dgri\GH14252-PA 282 GH14252-PA 45..267 27..252 559 45.1 Plus
Dgri\GH14067-PA 282 GH14067-PA 29..253 27..252 536 47.4 Plus
Dgri\GH14066-PA 271 GH14066-PA 33..269 19..256 525 41.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG17477-PA 267 CG17477-PA 1..267 1..267 1434 100 Plus
CG17475-PB 288 CG17475-PB 50..273 27..253 602 47.1 Plus
CG17475-PA 288 CG17475-PA 50..273 27..253 602 47.1 Plus
CG31265-PA 266 CG31265-PA 37..264 27..257 598 49.4 Plus
CG31269-PB 273 CG31269-PB 38..265 27..257 590 48.1 Plus
CG5255-PA 273 CG5255-PA 30..254 27..252 533 47.4 Plus
CG4053-PB 265 CG4053-PB 31..259 23..253 517 42.7 Plus
CG5246-PA 272 CG5246-PA 42..269 27..255 514 41.1 Plus
CG31266-PB 282 CG31266-PB 52..278 27..253 480 41 Plus
CG31267-PA 275 CG31267-PA 45..271 27..253 429 37.6 Plus
CG9676-PA 251 CG9676-PA 24..250 23..252 339 34 Plus
betaTry-PB 253 CG18211-PB 27..249 23..247 334 35.2 Plus
betaTry-PA 253 CG18211-PA 27..249 23..247 334 35.2 Plus
thetaTry-PA 262 CG12385-PA 35..255 27..247 334 35.7 Plus
alphaTry-PA 256 CG18444-PA 27..252 23..250 329 36.1 Plus
CG31954-PA 277 CG31954-PA 47..273 23..249 328 35.1 Plus
CG8299-PA 260 CG8299-PA 1..254 1..249 321 33.1 Plus
gammaTry-PA 253 CG30028-PA 2..249 7..247 320 32.5 Plus
CG30025-PA 253 CG30025-PA 2..249 7..247 320 32.5 Plus
deltaTry-PA 253 CG12351-PA 2..249 7..247 320 32.5 Plus
CG30031-PA 253 CG30031-PA 2..249 7..247 320 32.5 Plus
Ser6-PA 259 CG2071-PA 32..255 27..249 316 31.8 Plus
CG4653-PA 254 CG4653-PA 31..251 33..249 313 33.3 Plus
CG32523-PA 262 CG32523-PA 32..258 22..249 313 33.8 Plus
CG17571-PB 258 CG17571-PB 31..254 27..250 310 33.2 Plus
CG17571-PA 258 CG17571-PA 31..254 27..250 310 33.2 Plus
Ser8-PA 260 CG4812-PA 35..255 27..249 308 36.9 Plus
CG1304-PA 260 CG1304-PA 32..254 27..248 305 29.7 Plus
CG32808-PA 284 CG32808-PA 7..260 3..252 303 34.2 Plus
iotaTry-PA 252 CG7754-PA 28..245 27..247 298 34.7 Plus
epsilonTry-PA 256 CG18681-PA 27..252 23..250 295 30.9 Plus
Np-PB 1041 CG34350-PB 798..1039 27..251 291 33.5 Plus
Np-PA 1041 CG34350-PA 798..1039 27..251 291 33.5 Plus
CG12951-PA 265 CG12951-PA 30..258 27..248 283 33.2 Plus
CG16749-PA 265 CG16749-PA 30..260 27..250 281 32.1 Plus
CG7829-PA 253 CG7829-PA 28..250 27..252 277 31.4 Plus
CG34458-PA 257 CG34458-PA 6..253 2..249 272 30 Plus
CG6865-PB 285 CG6865-PB 35..283 27..253 271 32.8 Plus
CG32269-PB 332 CG32269-PB 109..332 27..254 269 31 Plus
CG32269-PA 332 CG32269-PA 109..332 27..254 269 31 Plus
CG32376-PA 291 CG32376-PA 66..288 27..251 266 30.2 Plus
CG8172-PD 371 CG8172-PD 126..369 27..254 265 29.1 Plus
CG8172-PE 545 CG8172-PE 300..543 27..254 265 29.1 Plus
CG8172-PF 561 CG8172-PF 316..559 27..254 265 29.1 Plus
CG32374-PA 299 CG32374-PA 74..294 27..249 262 31.1 Plus
CG11911-PA 277 CG11911-PA 36..271 26..252 261 33.9 Plus
CG10472-PA 290 CG10472-PA 47..281 27..249 261 33.3 Plus
yip7-PA 270 CG6457-PA 40..267 27..250 258 30.2 Plus
CG11912-PA 271 CG11912-PA 30..264 27..247 257 31 Plus
CG33160-PA 258 CG33160-PA 10..254 6..251 256 29.9 Plus
Send1-PA 255 CG17012-PA 14..239 11..247 255 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23145-PA 265 GI23145-PA 26..265 27..266 919 67.1 Plus
Dmoj\GI24438-PA 269 GI24438-PA 35..268 22..258 622 48.9 Plus
Dmoj\GI23142-PA 269 GI23142-PA 39..266 27..259 533 45.3 Plus
Dmoj\GI23144-PA 284 GI23144-PA 46..266 27..250 520 43.3 Plus
Dmoj\GI24442-PA 279 GI24442-PA 32..256 27..252 515 46.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27215-PA 268 GL27215-PA 1..267 1..265 1054 73 Plus
Dper\GL27272-PA 264 GL27272-PA 35..263 27..258 616 50 Plus
Dper\GL27216-PA 153 GL27216-PA 19..152 132..265 591 75.4 Plus
Dper\GL27214-PA 286 GL27214-PA 42..274 22..256 587 47.9 Plus
Dper\GL27271-PA 271 GL27271-PA 33..263 24..257 582 47.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14523-PA 268 GA14523-PA 25..267 24..265 1057 77 Plus
Dpse\GA14522-PA 286 GA14522-PA 42..274 22..256 587 47.9 Plus
Dpse\GA16138-PA 271 GA16138-PA 33..263 24..257 578 47.4 Plus
Dpse\GA18759-PA 273 GA18759-PA 40..270 24..255 543 43.6 Plus
Dpse\GA18766-PA 280 GA18766-PA 32..256 27..252 542 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15384-PA 267 GM15384-PA 1..267 1..267 1358 94 Plus
Dsec\GM15210-PA 266 GM15210-PA 37..264 27..257 578 48.9 Plus
Dsec\GM15383-PA 289 GM15383-PA 47..274 23..253 572 45 Plus
Dsec\GM15215-PA 273 GM15215-PA 30..254 27..252 528 46.9 Plus
Dsec\GM15382-PA 264 GM15382-PA 26..258 19..253 510 42.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20250-PA 267 GD20250-PA 1..267 1..267 1356 93.3 Plus
Dsim\GD20249-PA 288 GD20249-PA 46..273 23..253 582 45.5 Plus
Dsim\GD19141-PA 266 GD19141-PA 37..264 27..257 581 49.8 Plus
Dsim\GD19140-PA 274 GD19140-PA 36..267 24..258 577 47.2 Plus
Dsim\GD19145-PA 273 GD19145-PA 30..254 27..252 532 47.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10447-PA 268 GJ10447-PA 27..268 25..266 941 68.6 Plus
Dvir\GJ10713-PA 268 GJ10713-PA 39..267 27..258 619 50.4 Plus
Dvir\GJ10446-PA 290 GJ10446-PA 47..274 22..252 555 44.6 Plus
Dvir\GJ10717-PA 272 GJ10717-PA 35..270 19..256 531 41 Plus
Dvir\GJ10718-PA 280 GJ10718-PA 33..257 27..252 524 46.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10885-PA 274 GK10885-PA 33..273 25..265 1002 71.8 Plus
Dwil\GK12196-PA 282 GK12196-PA 34..273 27..266 613 48.6 Plus
Dwil\GK10884-PA 290 GK10884-PA 50..274 27..253 597 50.9 Plus
Dwil\GK12195-PA 272 GK12195-PA 31..265 21..258 579 47.1 Plus
Dwil\GK10883-PA 268 GK10883-PA 34..261 23..252 559 45.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26106-PA 267 GE26106-PA 1..267 1..267 1256 85.8 Plus
Dyak\GE26105-PA 296 GE26105-PA 46..273 23..253 597 47.2 Plus
Dyak\GE24613-PA 274 GE24613-PA 36..266 24..257 577 47.4 Plus
Dyak\GE24614-PA 266 GE24614-PA 37..264 27..257 576 48.5 Plus
Dyak\GE10113-PA 277 GE10113-PA 30..254 27..252 534 47.8 Plus