Clone IP09803 Report

Search the DGRC for IP09803

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:98
Well:3
Vector:pOT2
Associated Gene/TranscriptCG34391-RB
Protein status:IP09803.pep: gold
Preliminary Size:867
Sequenced Size:792

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34391 2008-04-29 Release 5.5 accounting
CG34391 2008-08-15 Release 5.9 accounting
CG34391 2008-12-18 5.12 accounting

Clone Sequence Records

IP09803.complete Sequence

792 bp (792 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023547

> IP09803.complete
TTCGAAATGTTTTTTCTTCCTTGCCCGCAGAGCCATTATCTATTGGGTAT
ACAATTCGGTGATGGTGTTGCCGAGCAAAAAGTATAAAACCGACTACACG
GAGAACTCCTATCGTGCCCACATGAAGCTGACGATAAGAAACCTACAATA
TGGTGACTTTGGCAACTATCGATGCATCTCGAAGAACTCGCTGGGGGAAA
CGGAAGGCTCCATACGTGTTTACGAAATACCTTTGCCATCCACACCATCC
AAGCAGGTTACCCACACCACCGTCGAGTCCAGGGAGAACAATATCATACC
CTCATCACGCAACGACACAACGAAATCCCTGCAAACGGATGTGGGATATG
CCATGAAGAACGATTTATATCCAGGCTCGGCCTCCTCGTCATCTTCGGGA
GGCAGTTCCTCGGCGGCCTCGTCCTCCTCCTCGATGCAGACCTCGGCATT
GCCAGGAGGAGTGGCGGGAAATAGTCTATCATCGATGGGCTCCAAAGGAT
CCTTGGCGATAGGCAAGAGCACGTTCTACACAGAACGACCACCGAATGAG
TACGCCGCCTCGTCAGTGGCTGGCCTGCTGCTTCATAGAGCATTGCTGTT
CGGCTCTGGAATCTATCTGACCCTGCTTTGAAATCAATAAATCGTTCGAG
TTAATCAATAAGCATTTGGAAAATGCAGCCAAAGGGGGTCTAGAAAAACG
GGGGAATAGTTTAGGTACATCATCATATTTCATAGCTGAAAGTATATCAA
AAATCCAATAATAATAATTAACAAACAAAAAAAAAAAAAAAA

IP09803.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG34391-RB 1170 CG34391-RB 14..793 1..780 3900 100 Plus
CG34391.b 2218 CG34391.b 1163..1912 31..780 3750 100 Plus
CG34391-RC 1746 CG34391-RC 695..1444 31..780 3750 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5431772..5432053 288..569 1395 99.6 Plus
chr3L 24539361 chr3L 5432112..5432320 569..776 995 99.5 Plus
chr3L 24539361 chr3L 5428782..5428895 1..114 555 99.1 Plus
chr3L 24539361 chr3L 5429105..5429215 114..224 555 100 Plus
chr3L 24539361 chr3L 5430295..5430358 224..287 320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5439190..5439471 288..569 1410 100 Plus
3L 28110227 3L 5439530..5439741 569..780 1060 100 Plus
3L 28110227 3L 5436199..5436312 1..114 570 100 Plus
3L 28110227 3L 5436522..5436632 114..224 555 100 Plus
3L 28110227 3L 5437712..5437775 224..287 320 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5432290..5432571 288..569 1410 100 Plus
3L 28103327 3L 5432630..5432841 569..780 1060 100 Plus
3L 28103327 3L 5429299..5429412 1..114 570 100 Plus
3L 28103327 3L 5429622..5429732 114..224 555 100 Plus
3L 28103327 3L 5430812..5430875 224..287 320 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:14:41 has no hits.

IP09803.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:15:21 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5429106..5429215 115..224 100 -> Plus
chr3L 5430296..5430358 225..287 100 -> Plus
chr3L 5431772..5432053 288..569 99 -> Plus
chr3L 5428782..5428895 1..114 99 -> Plus
chr3L 5432113..5432320 570..776 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:42:47 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RC 688..1293 25..631 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:59:46 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RC 688..1293 25..631 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:54 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RD 805..1410 25..631 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:52 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RC 688..1293 25..631 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:30 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RD 805..1410 25..631 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:42:58 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RB 1..776 1..776 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:59:46 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RB 1..776 1..776 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:54 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RB 1..776 1..776 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:52 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RB 1..776 1..776 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:30 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
CG34391-RB 41..816 1..776 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:15:21 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5436199..5436312 1..114 100 -> Plus
3L 5436523..5436632 115..224 100 -> Plus
3L 5437713..5437775 225..287 100 -> Plus
3L 5439190..5439471 288..569 100 -> Plus
3L 5439531..5439737 570..776 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:15:21 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5436199..5436312 1..114 100 -> Plus
3L 5436523..5436632 115..224 100 -> Plus
3L 5437713..5437775 225..287 100 -> Plus
3L 5439190..5439471 288..569 100 -> Plus
3L 5439531..5439737 570..776 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:15:21 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5436199..5436312 1..114 100 -> Plus
3L 5436523..5436632 115..224 100 -> Plus
3L 5437713..5437775 225..287 100 -> Plus
3L 5439190..5439471 288..569 100 -> Plus
3L 5439531..5439737 570..776 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:54 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5429299..5429412 1..114 100 -> Plus
arm_3L 5429623..5429732 115..224 100 -> Plus
arm_3L 5430813..5430875 225..287 100 -> Plus
arm_3L 5432290..5432571 288..569 100 -> Plus
arm_3L 5432631..5432837 570..776 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:14 Download gff for IP09803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5432290..5432571 288..569 100 -> Plus
3L 5432631..5432837 570..776 100   Plus
3L 5429299..5429412 1..114 100 -> Plus
3L 5429623..5429732 115..224 100 -> Plus
3L 5430813..5430875 225..287 100 -> Plus

IP09803.hyp Sequence

Translation from 0 to 630

> IP09803.hyp
SKCFFFLARRAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQY
GDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIP
SSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSAL
PGGVAGNSLSSMGSKGSLAIGKSTFYTERPPNEYAASSVAGLLLHRALLF
GSGIYLTLL*

IP09803.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34391-PE 469 CG34391-PE 270..469 10..209 1010 99.5 Plus
CG34391-PD 469 CG34391-PD 270..469 10..209 1010 99.5 Plus
CG34391-PB 189 CG34391-PB 1..189 21..209 953 100 Plus
CG31646-PA 606 CG31646-PA 356..522 10..167 204 30.5 Plus
CG42368-PA 467 CG42368-PA 273..446 2..168 180 29.4 Plus

IP09803.pep Sequence

Translation from 61 to 630

> IP09803.pep
MVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGS
IRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKN
DLYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLSSMGSKGSLAI
GKSTFYTERPPNEYAASSVAGLLLHRALLFGSGIYLTLL*

IP09803.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 01:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23978-PA 233 GF23978-PA 39..212 1..167 607 81.6 Plus
Dana\GF21356-PA 244 GF21356-PA 47..138 1..84 158 39.1 Plus
Dana\GF21699-PA 655 GF21699-PA 318..372 7..61 156 52.7 Plus
Dana\GF22310-PA 554 GF22310-PA 262..322 1..60 152 45.9 Plus
Dana\GF14310-PA 570 GF14310-PA 337..393 1..57 151 40.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 01:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15271-PA 287 GG15271-PA 39..287 1..189 779 73.1 Plus
Dere\GG24289-PA 606 GG24289-PA 369..425 1..57 158 43.9 Plus
Dere\GG10188-PA 672 GG10188-PA 322..376 7..61 157 52.7 Plus
Dere\GG17537-PA 251 GG17537-PA 46..163 1..116 155 33.1 Plus
Dere\GG18577-PA 555 GG18577-PA 284..344 1..60 149 47.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 01:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16256-PA 229 GH16256-PA 39..226 1..188 694 79.6 Plus
Dgri\GH24280-PA 394 GH24280-PA 169..275 1..95 165 38.3 Plus
Dgri\GH10697-PA 567 GH10697-PA 334..390 1..57 161 43.9 Plus
Dgri\GH13877-PA 391 GH13877-PA 274..328 7..61 156 52.7 Plus
Dgri\GH10699-PA 403 GH10699-PA 247..304 1..57 151 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
DIP-delta-PB 189 CG34391-PB 1..189 1..189 953 100 Plus
DIP-delta-PE 469 CG34391-PE 281..469 1..189 953 100 Plus
DIP-delta-PD 469 CG34391-PD 281..469 1..189 953 100 Plus
DIP-theta-PA 606 CG31646-PA 367..522 1..147 177 30.1 Plus
DIP-zeta-PC 512 CG31708-PC 358..511 5..150 168 33.1 Plus
DIP-epsilon-PA 467 CG42368-PA 293..446 1..148 165 29.9 Plus
CG31814-PB 643 CG31814-PB 322..376 7..61 158 52.7 Plus
CG31814-PA 672 CG31814-PA 322..376 7..61 158 52.7 Plus
DIP-zeta-PB 532 CG31708-PB 358..498 5..146 156 35.6 Plus
DIP-zeta-PA 532 CG31708-PA 358..498 5..146 156 35.6 Plus
DIP-eta-PB 450 CG14010-PB 281..405 1..120 154 34.6 Plus
DIP-eta-PD 450 CG14010-PD 281..405 1..120 154 34.6 Plus
DIP-beta-PG 534 CG42343-PG 330..444 1..113 151 33 Plus
DIP-beta-PF 555 CG42343-PF 351..465 1..113 151 33 Plus
DIP-beta-PC 555 CG42343-PC 351..465 1..113 151 33 Plus
DIP-alpha-PB 432 CG32791-PB 162..310 1..137 148 31.5 Plus
DIP-alpha-PC 554 CG32791-PC 284..432 1..137 148 31.5 Plus
DIP-alpha-PA 554 CG32791-PA 284..432 1..137 148 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 01:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13190-PA 467 GI13190-PA 255..462 1..186 606 70.9 Plus
Dmoj\GI21593-PA 234 GI21593-PA 47..137 1..84 169 41.8 Plus
Dmoj\GI10093-PA 691 GI10093-PA 317..371 7..61 158 52.7 Plus
Dmoj\GI11243-PA 571 GI11243-PA 338..394 1..57 152 42.1 Plus
Dmoj\GI11247-PA 470 GI11247-PA 285..342 1..57 151 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 01:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12247-PA 521 GL12247-PA 39..212 1..167 658 81 Plus
Dper\GL15980-PA 286 GL15980-PA 74..166 1..84 160 40.9 Plus
Dper\GL25687-PA 395 GL25687-PA 69..123 7..61 159 52.7 Plus
Dper\GL26641-PA 603 GL26641-PA 365..421 1..57 149 42.1 Plus
Dper\GL26643-PA 462 GL26643-PA 288..345 1..57 148 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 01:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23467-PA 453 GA23467-PA 255..451 1..189 736 79.8 Plus
Dpse\GA22895-PA 292 GA22895-PA 74..166 1..84 160 40.9 Plus
Dpse\GA16498-PA 684 GA16498-PA 328..382 7..61 158 52.7 Plus
Dpse\GA23218-PA 565 GA23218-PA 280..340 1..60 149 47.5 Plus
Dpse\GA29001-PA 462 GA29001-PA 288..345 1..57 148 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 01:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14704-PA 227 GM14704-PA 39..227 1..189 973 100 Plus
Dsec\GM25389-PA 675 GM25389-PA 322..376 7..61 157 52.7 Plus
Dsec\GM18007-PA 604 GM18007-PA 367..423 1..57 156 42.1 Plus
Dsec\GM12720-PA 550 GM12720-PA 284..344 1..60 149 47.5 Plus
Dsec\GM18009-PA 449 GM18009-PA 254..311 1..57 147 48.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 01:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13887-PA 288 GD13887-PA 39..288 1..189 781 74 Plus
Dsim\GD22051-PA 675 GD22051-PA 322..376 7..61 157 52.7 Plus
Dsim\GD22639-PA 514 GD22639-PA 367..423 1..57 156 42.1 Plus
Dsim\GD16325-PA 648 GD16325-PA 382..442 1..60 150 47.5 Plus
Dsim\GD22641-PA 531 GD22641-PA 364..421 1..57 148 48.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 01:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13403-PA 218 GJ13403-PA 39..205 1..168 674 86.5 Plus
Dvir\GJ15566-PA 461 GJ15566-PA 262..353 1..85 169 41.3 Plus
Dvir\GJ12336-PA 560 GJ12336-PA 334..390 1..57 158 42.1 Plus
Dvir\GJ18366-PA 670 GJ18366-PA 312..366 7..61 157 52.7 Plus
Dvir\GJ15333-PA 556 GJ15333-PA 284..344 1..60 147 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 01:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17315-PA 253 GK17315-PA 39..204 1..166 676 82.6 Plus
Dwil\GK24547-PA 614 GK24547-PA 309..363 7..61 162 52.7 Plus
Dwil\GK16718-PA 551 GK16718-PA 284..350 1..64 152 46.3 Plus
Dwil\GK15428-PA 950 GK15428-PA 363..419 1..57 148 42.1 Plus
Dwil\GK23705-PA 528 GK23705-PA 345..436 1..90 147 38 Plus
Dwil\GK15428-PA 950 GK15428-PA 785..842 1..57 146 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 01:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21492-PA 282 GE21492-PA 39..282 1..189 726 74.2 Plus
Dyak\GE11503-PA 661 GE11503-PA 322..376 7..61 158 52.7 Plus
Dyak\GE18984-PA 573 GE18984-PA 336..392 1..57 156 42.1 Plus
Dyak\GE15296-PA 337 GE15296-PA 130..189 1..59 152 48.3 Plus
Dyak\GE16888-PA 551 GE16888-PA 284..344 1..60 149 47.5 Plus