Clone IP09861 Report

Search the DGRC for IP09861

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:98
Well:61
Vector:pOT2
Associated Gene/TranscriptCG42560-RA
Protein status:IP09861.pep: gold
Preliminary Size:842
Sequenced Size:839

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30182 2005-01-01 Successful iPCR screen
CG30182 2008-04-29 Release 5.5 accounting
CG30182 2008-08-15 Release 5.9 accounting
apt 2008-08-15 Release 5.9 accounting
CG30182 2008-12-18 5.12 accounting
apt 2008-12-18 5.12 accounting

Clone Sequence Records

IP09861.complete Sequence

839 bp (839 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023218.1

> IP09861.complete
CTGCCACACTGATTTCGTTCTATCCTAAACTTAAGAAGCCATGTTTCCTG
TTGCACGAATCTTAGGCTCGGCATCGTGCAACAGGCTATTTCAACCTCAG
GTGCTATGTCAAGAAAGAGTTTGTTGGCCTTCCAATGAGTTGCACAGAAA
TTTACCAAGGCATAGAAACTTTTACCACGGTAGAAACATTTTCCACCCAA
GGTCGAATAATAATTTAAACGAATTTCCTGCTAAACGTCAATTCACTGAC
AAATTTTCCGAGAAGGGCAGAGGCGAGGAACTTAACTATGTTCTCAAACT
TGCCTCAGAGCAATTTATGAAGATAAAAAAGAACAGGGTTAAAGAAATCG
CCAATGATATCGTCAAATTGAAAGAGGAGATCAAGATTTTGGAATCCAAA
ACTAGCCACAAATCAAGGAAACACAAGGAGAATCTGCTAAAGGAATTGAA
AGCTCTGAAGGATTTGTTGGAGCAATTCAAAAAGAGTCTCGAAAAATGAC
CTATCAAACGGATACAATGCTGAAGTTGGTCGAAAAGCTTTTCCAACTGT
TGCGACCCAGGATGTGTCAGTTTTCACAATCCAACAAGAACATATCCAAG
CATTTGTTCGAAAAAGCCAGGGCGGAGGAGAACATACATTTCCTTAAACT
GCAACGGGAACAGCTGAAGTCGTTGCGAGAAAAGATTCTCAGCCAGAAGA
ACGAAGTCACAACAAAGATCATCAAGGTGGATAAGCAGATACAATCGTTG
GAAAAAACCAAGACCGAAGGCTCACAGATGAACCATGAACAAAATTAATA
AAGTGTAGCTGAAACATTAAAAAAAAAAAAAAAAAAAAA

IP09861.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42560-RA 878 CG42560-RA 61..878 1..818 4090 100 Plus
CG42559-RC 940 CG42559-RC 61..711 1..651 3255 100 Plus
CG42559-RB 937 CG42559-RB 61..648 1..588 2940 100 Plus
CG42559-RB 937 CG42559-RB 707..937 588..818 1155 100 Plus
CG42559-RC 940 CG42559-RC 773..940 651..818 840 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19486302..19486502 502..302 975 99 Minus
chr2R 21145070 chr2R 19485764..19485931 818..651 825 99.4 Minus
chr2R 21145070 chr2R 19486852..19486974 123..1 615 100 Minus
chr2R 21145070 chr2R 19486686..19486797 234..123 560 100 Minus
chr2R 21145070 chr2R 19486115..19486193 588..510 395 100 Minus
chr2R 21145070 chr2R 19486560..19486627 302..235 340 100 Minus
chr2R 21145070 chr2R 19485993..19486056 651..588 305 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23600046..23600255 511..302 1050 100 Minus
2R 25286936 2R 23599528..23599695 818..651 840 100 Minus
2R 25286936 2R 23600605..23600727 123..1 615 100 Minus
2R 25286936 2R 23600439..23600550 234..123 560 100 Minus
2R 25286936 2R 23599879..23599957 588..510 395 100 Minus
2R 25286936 2R 23600313..23600380 302..235 340 100 Minus
2R 25286936 2R 23599757..23599820 651..588 320 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23601245..23601454 511..302 1050 100 Minus
2R 25260384 2R 23600727..23600894 818..651 840 100 Minus
2R 25260384 2R 23601804..23601926 123..1 615 100 Minus
2R 25260384 2R 23601638..23601749 234..123 560 100 Minus
2R 25260384 2R 23601078..23601156 588..510 395 100 Minus
2R 25260384 2R 23601512..23601579 302..235 340 100 Minus
2R 25260384 2R 23600956..23601019 651..588 320 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:24:46 has no hits.

IP09861.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:25:53 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19486686..19486796 124..234 100 <- Minus
chr2R 19486852..19486974 1..123 100   Minus
chr2R 19485764..19485930 652..818 99 <- Minus
chr2R 19485993..19486056 588..651 98 <- Minus
chr2R 19486116..19486192 511..587 100 <- Minus
chr2R 19486292..19486502 302..510 97 <- Minus
chr2R 19486561..19486627 235..301 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:25 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG30182-RA 1..750 41..798 96   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:38 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG42559-RC 1..459 41..499 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:13:54 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG42559-RA 1..459 41..499 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:01:56 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG30182-RA 1..750 41..798 96   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:13:09 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG42559-RA 1..459 41..499 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:14 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG30182-RA 28..837 1..818 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:38 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG42560-RA 61..878 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:13:54 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG42559-RA 61..878 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:01:57 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG30182-RA 28..837 1..818 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:13:09 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
CG42559-RA 61..878 1..818 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:53 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23600047..23600255 302..510 100 <- Minus
2R 23600314..23600380 235..301 100 <- Minus
2R 23600439..23600549 124..234 100 <- Minus
2R 23600605..23600727 1..123 100   Minus
2R 23599880..23599956 511..587 100 <- Minus
2R 23599528..23599694 652..818 100 <- Minus
2R 23599757..23599820 588..651 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:53 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23600047..23600255 302..510 100 <- Minus
2R 23600314..23600380 235..301 100 <- Minus
2R 23600439..23600549 124..234 100 <- Minus
2R 23600605..23600727 1..123 100   Minus
2R 23599880..23599956 511..587 100 <- Minus
2R 23599528..23599694 652..818 100 <- Minus
2R 23599757..23599820 588..651 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:53 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23600047..23600255 302..510 100 <- Minus
2R 23600314..23600380 235..301 100 <- Minus
2R 23600439..23600549 124..234 100 <- Minus
2R 23600605..23600727 1..123 100   Minus
2R 23599880..23599956 511..587 100 <- Minus
2R 23599528..23599694 652..818 100 <- Minus
2R 23599757..23599820 588..651 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:13:54 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19487051..19487217 652..818 100 <- Minus
arm_2R 19487280..19487343 588..651 100 <- Minus
arm_2R 19487403..19487479 511..587 100 <- Minus
arm_2R 19487570..19487778 302..510 100 <- Minus
arm_2R 19487837..19487903 235..301 100 <- Minus
arm_2R 19487962..19488072 124..234 100 <- Minus
arm_2R 19488128..19488250 1..123 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:44 Download gff for IP09861.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23601264..23601472 302..510 100 <- Minus
2R 23601531..23601597 235..301 100 <- Minus
2R 23601656..23601766 124..234 100 <- Minus
2R 23601822..23601944 1..123 100   Minus
2R 23600745..23600911 652..818 100 <- Minus
2R 23600974..23601037 588..651 100 <- Minus
2R 23601097..23601173 511..587 100 <- Minus

IP09861.hyp Sequence

Translation from 40 to 498

> IP09861.hyp
MFPVARILGSASCNRLFQPQVLCQERVCWPSNELHRNLPRHRNFYHGRNI
FHPRSNNNLNEFPAKRQFTDKFSEKGRGEELNYVLKLASEQFMKIKKNRV
KEIANDIVKLKEEIKILESKTSHKSRKHKENLLKELKALKDLLEQFKKSL
EK*

IP09861.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42559-PC 152 CG42559-PC 1..152 1..152 794 100 Plus
CG42559-PB 152 CG42559-PB 1..152 1..152 794 100 Plus
CG42559-PA 152 CG42559-PA 1..152 1..152 794 100 Plus

IP09861.pep Sequence

Translation from 495 to 797

> IP09861.pep
MTYQTDTMLKLVEKLFQLLRPRMCQFSQSNKNISKHLFEKARAEENIHFL
KLQREQLKSLREKILSQKNEVTTKIIKVDKQIQSLEKTKTEGSQMNHEQN
*

IP09861.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11834-PA 179 GF11834-PA 92..172 8..88 256 60.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20017-PA 85 GG20017-PA 1..85 8..92 373 87.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42560-PB 93 CG42560-PB 1..93 8..100 462 100 Plus
CG42560-PA 93 CG42560-PA 1..93 8..100 462 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19034-PA 97 GI19034-PA 33..91 33..91 135 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17600-PA 89 GL17600-PA 1..87 8..94 192 49.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30494-PA 89 GA30494-PA 1..87 8..94 199 49.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15528-PA 254 GM15528-PA 160..254 6..100 456 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25032-PA 254 GD25032-PA 160..254 6..100 468 96.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11553-PA 93 GE11553-PA 1..93 8..100 421 88.2 Plus