Clone IP09869 Report

Search the DGRC for IP09869

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:98
Well:69
Vector:pOT2
Associated Gene/Transcriptantr-RA
Protein status:IP09869.pep: gold
Preliminary Size:819
Sequenced Size:908

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30488 2005-01-01 Successful iPCR screen
CG30488 2008-04-29 Release 5.5 accounting
CG30488 2008-08-15 Release 5.9 accounting
CG30488 2008-12-18 5.12 accounting

Clone Sequence Records

IP09869.complete Sequence

908 bp assembled on 2006-11-09

GenBank Submission: BT023222

> IP09869.complete
ATGAAGATGTGGTATCTGTACCTCTTTTTGTTACCGCTAACTGCGAGCTT
GATACCAGAAGATGATCCCCATTGTAAGCCCAATCTCTGCATGAACTCGG
AAATTCATGCAGTAGGTGAGCAATGCGGGAAAAACAATCTGTTCCTGAAC
GTTAATGGAGCCTTGAAGACTGGCATCCTCAGCAGGATCAACATGTTGCG
CAACTATGTGGCCAGTGGAGTGGGCAACTATTCGGTAGCCGCTCGCATGC
CGACGATGGGCTGGGATTTTGAACTGCAGAGGCTGGCGGATAGACAGGTT
CGCCAATGCGATGAGACGGGAAAGTTTTGCGCCAATACCGACAAGTATCA
CTATGTGGCAACCACCGAAATCCGTAGCAAGATGGGACGGACCAAGAGCC
TTAAAAGTGCGATTTTAGATAAATTGCTGCCGGAGTTGTTTCTGGATGTC
ATGGGATGCATGATGAACAGTCAGAAATTAGTGCCAGTAAGAGAAGGAAC
CTGTGTGGGCCACTATATGCCCCTGATTCAGGACCATGGTTCTCGTATGG
GATGCGGCCTTCGTGTGAAAGGTAGGGACGAGAAGGAGTCAAATATTATC
CTGCTCTGCCACTTTTCGCGGGCCAGTGTGAACAACCTGGTTCCGTACGA
AGAGGGCCAGATTCCTGCCGGGAAGTGCGCCACTGGACCGAGCCAGATGT
ACCAGTTCCTCTGCAGCGAGGATGAGTACGTCGATGCCAACAGCATGGTG
GTGGAATCGAATATGCCGTCCAGCGACCAAATACAAGTGGACATTTAGGG
TGTTATATAATTGTACACTTATAAAATAAGTGCTTATGCACTTAATATTC
ACATAAATACTATTCATGAAATAAAAACCTTTAAAATCGAAAAAAAAAAA
AAAAAAAA

IP09869.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG30488-RA 896 CG30488-RA 8..896 1..889 4445 100 Plus
CG30488.a 917 CG30488.a 137..917 109..889 3905 100 Plus
CG30488.a 917 CG30488.a 8..116 1..109 545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8734148..8734540 889..497 1965 100 Minus
chr2R 21145070 chr2R 8734728..8735116 497..109 1945 100 Minus
chr2R 21145070 chr2R 8735189..8735297 109..1 545 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12846847..12847240 890..497 1970 100 Minus
2R 25286936 2R 12847428..12847816 497..109 1945 100 Minus
2R 25286936 2R 12847889..12847997 109..1 545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12848046..12848439 890..497 1970 100 Minus
2R 25260384 2R 12848627..12849015 497..109 1945 100 Minus
2R 25260384 2R 12849088..12849196 109..1 545 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:20:43 has no hits.

IP09869.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:21:56 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8734148..8734539 498..889 100 <- Minus
chr2R 8734728..8735116 109..497 100 <- Minus
chr2R 8735190..8735297 1..108 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:30 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 1..798 1..798 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:19 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 1..798 1..798 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:15 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 1..798 1..798 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:34:40 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 1..798 1..798 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:36 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
antr-RA 1..798 1..798 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:47:38 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 22..910 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:19 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 8..896 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:15 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 8..896 1..889 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:34:41 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
CG30488-RA 22..910 1..889 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:36 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
antr-RA 8..896 1..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:56 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12846848..12847239 498..889 100 <- Minus
2R 12847428..12847816 109..497 100 <- Minus
2R 12847890..12847997 1..108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:56 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12846848..12847239 498..889 100 <- Minus
2R 12847428..12847816 109..497 100 <- Minus
2R 12847890..12847997 1..108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:56 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12846848..12847239 498..889 100 <- Minus
2R 12847428..12847816 109..497 100 <- Minus
2R 12847890..12847997 1..108 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:15 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8734353..8734744 498..889 100 <- Minus
arm_2R 8734933..8735321 109..497 100 <- Minus
arm_2R 8735395..8735502 1..108 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:41 Download gff for IP09869.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12848047..12848438 498..889 100 <- Minus
2R 12848627..12849015 109..497 100 <- Minus
2R 12849089..12849196 1..108 100   Minus

IP09869.pep Sequence

Translation from 0 to 797

> IP09869.pep
MKMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHAVGEQCGKNNLFLN
VNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQV
RQCDETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDV
MGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNII
LLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVDANSMV
VESNMPSSDQIQVDI*

IP09869.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12003-PA 273 GF12003-PA 21..263 25..256 671 53.1 Plus
Dana\GF12002-PA 262 GF12002-PA 2..256 8..249 304 31.9 Plus
Dana\GF12998-PA 288 GF12998-PA 2..250 6..249 228 24.4 Plus
Dana\GF12004-PA 289 GF12004-PA 24..285 24..249 219 25.6 Plus
Dana\GF21598-PA 255 GF21598-PA 3..255 6..249 199 24.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22547-PA 265 GG22547-PA 1..265 1..265 1131 78.5 Plus
Dere\GG22546-PA 263 GG22546-PA 22..257 24..249 286 29.6 Plus
Dere\GG19450-PA 288 GG19450-PA 37..288 6..249 202 25.7 Plus
Dere\GG22996-PA 308 GG22996-PA 26..255 24..249 201 25.3 Plus
Dere\GG18928-PA 253 GG18928-PA 7..249 4..247 191 26.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12878-PA 260 GH12878-PA 31..257 25..248 182 27 Plus
Dgri\GH24944-PA 305 GH24944-PA 75..304 37..256 165 24.3 Plus
Dgri\GH17451-PA 253 GH17451-PA 4..249 8..242 153 25.9 Plus
Dgri\GH21186-PA 270 GH21186-PA 13..263 8..247 150 25.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
antr-PA 265 CG30488-PA 1..265 1..265 1409 100 Plus
antr-PB 272 CG30488-PB 1..272 1..265 1391 97.4 Plus
CG30486-PA 263 CG30486-PA 1..257 3..249 305 29.7 Plus
CG3640-PA 296 CG3640-PA 4..255 1..249 210 25 Plus
Ag5r2-PA 254 CG9540-PA 3..253 6..248 193 24.2 Plus
CG32679-PA 254 CG32679-PA 8..250 3..247 190 25.8 Plus
CG17974-PA 259 CG17974-PA 18..258 17..247 184 29.7 Plus
CG42564-PA 500 CG10284-PA 55..281 24..242 172 26.6 Plus
CG9400-PA 308 CG9400-PA 82..307 42..256 159 24.1 Plus
CG9822-PA 263 CG9822-PA 27..259 25..247 152 24.9 Plus
CG34002-PB 350 CG34002-PB 20..257 8..244 149 26.2 Plus
CG42780-PA 253 CG42780-PA 1..252 1..240 148 22.7 Plus
CG42780-PB 254 CG42780-PB 1..253 1..240 147 22.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20219-PA 245 GI20219-PA 2..225 35..255 372 34.2 Plus
Dmoj\GI15747-PA 256 GI15747-PA 40..254 37..249 225 27.9 Plus
Dmoj\GI15745-PA 257 GI15745-PA 44..254 41..249 215 29.2 Plus
Dmoj\GI20220-PA 283 GI20220-PA 21..278 18..250 191 24.2 Plus
Dmoj\GI15744-PA 256 GI15744-PA 6..252 6..242 160 24.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17455-PA 274 GL17455-PA 31..265 25..249 593 49.8 Plus
Dper\GL17454-PA 264 GL17454-PA 46..258 40..249 282 31.5 Plus
Dper\GL17456-PA 291 GL17456-PA 17..285 14..250 208 23 Plus
Dper\GL11846-PA 261 GL11846-PA 28..260 25..247 165 26.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24200-PB 267 GA24200-PB 31..258 25..249 626 50.9 Plus
Dpse\GA24200-PA 274 GA24200-PA 31..265 25..249 608 49.4 Plus
Dpse\GA24199-PA 264 GA24199-PA 46..258 40..249 284 31.5 Plus
Dpse\GA24199-PB 206 GA24199-PB 3..200 55..249 269 31.8 Plus
Dpse\GA14563-PB 298 GA14563-PB 17..292 14..250 209 22.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20332-PA 265 GM20332-PA 1..265 1..265 1330 91.3 Plus
Dsec\GM20331-PA 263 GM20331-PA 2..257 8..249 307 29.1 Plus
Dsec\GM20333-PA 291 GM20333-PA 25..288 24..250 212 22.7 Plus
Dsec\GM11889-PA 296 GM11889-PA 4..255 1..249 207 25.1 Plus
Dsec\GM12040-PA 254 GM12040-PA 3..254 6..249 200 24.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25809-PA 265 GD25809-PA 1..265 1..265 1330 90.9 Plus
Dsim\GD25808-PA 263 GD25808-PA 2..257 8..249 321 29.8 Plus
Dsim\GD11888-PA 299 GD11888-PA 4..255 1..249 212 25.5 Plus
Dsim\GD25810-PA 291 GD25810-PA 25..288 24..250 209 22.3 Plus
Dsim\GD16039-PA 254 GD16039-PA 7..250 4..247 190 26.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20169-PA 337 GJ20169-PA 30..256 19..247 444 38.2 Plus
Dvir\GJ20170-PA 288 GJ20170-PA 6..283 4..250 219 25 Plus
Dvir\GJ18491-PA 324 GJ18491-PA 92..321 24..248 175 25.1 Plus
Dvir\GJ24603-PA 345 GJ24603-PA 5..234 37..262 167 27.2 Plus
Dvir\GJ14736-PA 270 GJ14736-PA 24..264 13..247 162 25.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20882-PA 255 GK20882-PA 18..252 25..250 584 48.5 Plus
Dwil\GK20884-PA 274 GK20884-PA 20..267 24..245 207 24 Plus
Dwil\GK25699-PA 253 GK25699-PA 2..249 1..247 201 25.9 Plus
Dwil\GK14719-PA 256 GK14719-PA 23..256 24..249 199 25.5 Plus
Dwil\GK15903-PA 518 GK15903-PA 33..278 23..258 190 27.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13418-PA 265 GE13418-PA 1..265 1..265 1229 83 Plus
Dyak\GE13416-PA 263 GE13416-PA 22..257 24..249 305 31.2 Plus
Dyak\GE14433-PA 296 GE14433-PA 6..255 3..249 227 26.4 Plus
Dyak\GE13419-PA 300 GE13419-PA 27..297 24..250 216 22.9 Plus
Dyak\GE16103-PA 283 GE16103-PA 35..283 8..249 197 25.5 Plus

IP09869.hyp Sequence

Translation from 1 to 797

> IP09869.hyp
MKMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHAVGEQCGKNNLFLN
VNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQV
RQCDETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDV
MGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNII
LLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVDANSMV
VESNMPSSDQIQVDI*

IP09869.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
antr-PA 265 CG30488-PA 1..265 1..265 1409 100 Plus
antr-PB 272 CG30488-PB 1..272 1..265 1391 97.4 Plus
CG30486-PA 263 CG30486-PA 1..257 3..249 305 29.7 Plus
CG30486-PB 219 CG30486-PB 3..213 42..249 287 31.5 Plus
CG3640-PA 296 CG3640-PA 4..255 1..249 210 25 Plus