Clone IP09871 Report

Search the DGRC for IP09871

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:98
Well:71
Vector:pOT2
Associated Gene/TranscriptCG31111-RA
Protein status:IP09871.pep: gold
Preliminary Size:810
Sequenced Size:953

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31111 2008-04-29 Release 5.5 accounting
CG31111 2008-08-15 Release 5.9 accounting
CG31111 2008-12-18 5.12 accounting

Clone Sequence Records

IP09871.complete Sequence

953 bp (953 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023540

> IP09871.complete
CAATAACAACAAACAAATCGTATCTCTTGTTTTTGCTGAAATTATAAATT
AAAAAGCAATGAATTTAAAGTATAAGCGGCGCTACGAGAGCTTAAAACGC
TCCGTCAAGAGTTATCTACTGGAGAACGCCGCCCTCACGGATGAGATCTG
TCGTCTGCAGGCCGAACTATCTGTGACCCGATCCCAAAGACTTTACTTGA
TAGAGCGCCTCATGTTTCACGAGGGCTTGGAGAAATCCAACAGTGGACGA
CCCAGTGTCTCGAATGGAAAAAACGACGCCGCTGAAACCACAAAGAAATA
CAGTCCTGTAGTTTCGCATAAGAACCCCGTCGAAGATAAGCCAAAAAATG
TTACAATTGTACGGAAAAAGAAGCCCATGTTTCCGATGAACCTAAATAAT
GTATTACTCCACTCACTGGGCGAGATTATATCAGTGAATCCCAATTTTCA
CACTGAGAGCTGGATATATCCCGTGGGATATGTGGCCACACGAATCTACG
CCCATCCCAAGGATCCGCGCAAGAAGTGTGTGTTCACATGTAAGATTTTA
AATAACGCCGGGATTCCTCAGTTCCAAATAATACCCGACAATGATCTGGA
TGGAGTTTTCTTCGGAGAAAGCGCCAATATGTGTCACATGGAGCTTCTTA
ACTCCATTCAGCGGTCTCCCTGCGTTAAAATTAAAATACCGTTCGACGTA
CAGGGCGAGGTTTTCTTTGGCTTGTCAAACCAAAAAACACAATCGCTGCT
TATGATGGATCCTGCCTTTCATCAGTGCACGAATTTCAAGGGATTCGCGG
TGCAGAATGTTCAGTCCTTAAACAGCGCGTCTTTATCCTTTGAGACGCTC
CAGGGATTTCTATCTTGATAAGATCTGTTTTTACTATTTGATTCTCGATA
TAAGAATAATAAGTTTATAATATAAAGACGAAAAAAAAAAAAAAAAAAAA
AAA

IP09871.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31111-RA 1113 CG31111-RA 71..1002 1..932 4630 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20878247..20879056 930..121 4020 99.8 Minus
chr3R 27901430 chr3R 20879205..20879326 122..1 595 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25055074..25055885 932..121 4030 99.8 Minus
3R 32079331 3R 25056034..25056155 122..1 610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24795905..24796716 932..121 4030 99.7 Minus
3R 31820162 3R 24796865..24796986 122..1 610 100 Minus
Blast to na_te.dros performed 2019-03-16 16:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Galileo 2304 Dbuz\Galileo GALILEO 2304bp 1115..1211 2..96 111 60.2 Plus

IP09871.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:08:55 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20879206..20879326 1..121 99   Minus
chr3R 20878247..20879055 122..930 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:31 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 1..810 59..868 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:14 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 1..810 59..868 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:40 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 1..810 59..868 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:46 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 1..810 59..868 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:20:22 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 1..810 59..868 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:42:48 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 23..952 1..930 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:14 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 23..952 1..930 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:40 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 23..952 1..930 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:46 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 23..952 1..930 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:20:22 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
CG31111-RA 23..952 1..930 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:55 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25055076..25055884 122..930 99 <- Minus
3R 25056035..25056155 1..121 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:55 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25055076..25055884 122..930 99 <- Minus
3R 25056035..25056155 1..121 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:55 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25055076..25055884 122..930 99 <- Minus
3R 25056035..25056155 1..121 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:40 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20880798..20881606 122..930 99 <- Minus
arm_3R 20881757..20881877 1..121 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:43 Download gff for IP09871.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24795907..24796715 122..930 99 <- Minus
3R 24796866..24796986 1..121 100   Minus

IP09871.hyp Sequence

Translation from 58 to 867

> IP09871.hyp
MNLKYKRRYESLKRSVKSYLLENAALTDEICRLQAELSVTRSQRLYLIER
LMFHEGLEKSNSGRPSVSNGKNDAAETTKKYSPVVSHKNPVEDKPKNVTI
VRKKKPMFPMNLNNVLLHSLGEIISVNPNFHTESWIYPVGYVATRIYAHP
KDPRKKCVFTCKILNNAGIPQFQIIPDNDLDGVFFGESANMCHMELLNSI
QRSPCVKIKIPFDVQGEVFFGLSNQKTQSLLMMDPAFHQCTNFKGFAVQN
VQSLNSASLSFETLQGFLS*

IP09871.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31111-PA 269 CG31111-PA 1..269 1..269 1404 100 Plus

IP09871.pep Sequence

Translation from 58 to 867

> IP09871.pep
MNLKYKRRYESLKRSVKSYLLENAALTDEICRLQAELSVTRSQRLYLIER
LMFHEGLEKSNSGRPSVSNGKNDAAETTKKYSPVVSHKNPVEDKPKNVTI
VRKKKPMFPMNLNNVLLHSLGEIISVNPNFHTESWIYPVGYVATRIYAHP
KDPRKKCVFTCKILNNAGIPQFQIIPDNDLDGVFFGESANMCHMELLNSI
QRSPCVKIKIPFDVQGEVFFGLSNQKTQSLLMMDPAFHQCTNFKGFAVQN
VQSLNSASLSFETLQGFLS*

IP09871.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17107-PA 273 GF17107-PA 1..273 1..269 1110 75.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12293-PA 269 GG12293-PA 1..269 1..269 1388 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18028-PA 275 GH18028-PA 6..274 3..269 784 54.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG31111-PA 269 CG31111-PA 1..269 1..269 1404 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21891-PA 272 GL21891-PA 1..272 1..269 839 63.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16017-PA 272 GA16017-PA 1..272 1..269 841 63.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17759-PA 269 GM17759-PA 1..269 1..269 1423 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18240-PA 269 GD18240-PA 1..269 1..269 1431 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23612-PA 271 GJ23612-PA 12..269 12..268 752 56.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10844-PA 273 GK10844-PA 3..273 4..269 890 62.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10746-PA 269 GE10746-PA 1..269 1..269 1373 94.4 Plus