Clone IP09891 Report

Search the DGRC for IP09891

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:98
Well:91
Vector:pOT2
Associated Gene/TranscriptCG31851-RA
Protein status:IP09891.pep: gold
Preliminary Size:818
Sequenced Size:822

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31851 2008-04-29 Release 5.5 accounting
CG31851 2008-08-15 Release 5.9 accounting
CG31851 2008-12-18 5.12 accounting

Clone Sequence Records

IP09891.complete Sequence

822 bp (822 high quality bases) assembled on 2006-04-14

GenBank Submission: BT025113

> IP09891.complete
TTAGTTCATCGGTGATTTCGAGATCTTTAAAACATATTTTGGTTTAGCGT
ACAAAGTAGTAACTGAGGAAAAAAAATATGTCACATTAACAAAGTAAACA
TAATATTGAACAAGATAAAAAAATTCCTATTATATCCCAGCGAGTCATGA
CTTCTCCGAGATTGTTTGTTCTCGAAGATCTGTTCAAGTTTAACAATATT
GTGATGGATCCCTTGGCGGAAGTGTACTCCTTGCCATTCTTGCTTCCCAA
GATTCTGGAGCATCCCGAACTGGTTCTTGCCGCCGATGCTCCTGACAATA
GTCTCATGGGCTTCATTCTGGGGACACGCGTCGAGGATGCGACTGAATCT
TTTGGAGATGCAAAGACTATGACCTGGAATCATGGACACATCTCTGCTCT
GGCCGTAGCTCAGGATTATCGTAAACTGGGCTTGGGCACTCGGCTCTTAA
CAACCGTTAGGGATATGATGGATCGTCAGAAAGACTTTTATATAGATCTA
TTTGTGCGAGAGAAGAATACAATTGCCATTGGGCTTTACGAGTCCTTGGG
ATATGTGAAATATCGCTGGATACCTAAGTTTTATGCCGACGACCATGGAT
ACGAAATGAGACTACCTTTGTCCAGCGATGTGGATAGGAAATCCTTAGAG
GGAATAATAATCAAGAAAATCTACAGCTTTGGCAATAAGTTGTACTATCT
GCTGATGTTTTACATATTCGGAATTATAGCTATAGTTATTGGTGGAATAT
TGGTTGAATAAGCAATTGTAGTAAAACCAAACTATTAAACTTTATTTGGC
ATCAAAAAAAAAAAAAAAAAAA

IP09891.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG31851-RA 860 CG31851-RA 58..860 1..803 4015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13256197..13256999 1..803 3940 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13257534..13258340 1..807 4035 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13257534..13258340 1..807 4035 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:58:28 has no hits.

IP09891.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:59:31 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13256197..13256999 1..803 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:37 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 1..615 147..761 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:49 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 1..615 147..761 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:01:25 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 1..615 147..761 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:32 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 1..615 147..761 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:06 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 1..615 147..761 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:24:30 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 58..818 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:48 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 58..860 1..803 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:01:25 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 58..860 1..803 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:32 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 58..818 1..761 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:06 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
CG31851-RA 58..860 1..803 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:31 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13257534..13258336 1..803 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:31 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13257534..13258336 1..803 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:31 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13257534..13258336 1..803 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:01:25 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13257534..13258336 1..803 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:10:00 Download gff for IP09891.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13257534..13258336 1..803 100   Plus

IP09891.hyp Sequence

Translation from 146 to 760

> IP09891.hyp
MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPD
NSLMGFILGTRVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRL
LTTVRDMMDRQKDFYIDLFVREKNTIAIGLYESLGYVKYRWIPKFYADDH
GYEMRLPLSSDVDRKSLEGIIIKKIYSFGNKLYYLLMFYIFGIIAIVIGG
ILVE*

IP09891.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG31851-PB 204 CG31851-PB 1..204 1..204 1052 100 Plus
CG31851-PA 204 CG31851-PA 1..204 1..204 1052 100 Plus
NAA20-PD 175 CG14222-PD 1..160 1..167 343 40 Plus
NAA20-PC 175 CG14222-PC 1..160 1..167 343 40 Plus
NAA20-PA 175 CG14222-PA 1..160 1..167 343 40 Plus

IP09891.pep Sequence

Translation from 146 to 760

> IP09891.pep
MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPD
NSLMGFILGTRVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRL
LTTVRDMMDRQKDFYIDLFVREKNTIAIGLYESLGYVKYRWIPKFYADDH
GYEMRLPLSSDVDRKSLEGIIIKKIYSFGNKLYYLLMFYIFGIIAIVIGG
ILVE*

IP09891.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23106-PA 205 GF23106-PA 1..204 1..204 674 62.7 Plus
Dana\GF20277-PA 175 GF20277-PA 1..160 1..167 344 40 Plus
Dana\GF21684-PA 165 GF21684-PA 1..152 1..155 232 37.5 Plus
Dana\GF13618-PA 197 GF13618-PA 4..179 5..181 140 27.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23832-PA 203 GG23832-PA 1..202 1..203 879 81.3 Plus
Dere\GG18041-PA 175 GG18041-PA 1..160 1..167 344 40 Plus
Dere\GG10216-PA 162 GG10216-PA 1..152 1..155 219 34.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22808-PA 169 GH22808-PA 1..161 1..167 339 37.4 Plus
Dgri\GH24558-PA 175 GH24558-PA 1..160 1..167 339 40 Plus
Dgri\GH25096-PA 182 GH25096-PA 1..164 1..168 309 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Naa20B-PB 204 CG31851-PB 1..204 1..204 1052 100 Plus
Naa20B-PA 204 CG31851-PA 1..204 1..204 1052 100 Plus
Naa20A-PD 175 CG14222-PD 1..160 1..167 343 40 Plus
Naa20A-PC 175 CG14222-PC 1..160 1..167 343 40 Plus
Naa20A-PA 175 CG14222-PA 1..160 1..167 343 40 Plus
Naa20A-PB 180 CG14222-PB 1..160 1..167 343 40 Plus
CG31730-PA 162 CG31730-PA 1..152 1..155 228 37.3 Plus
vnc-PB 196 CG11989-PB 9..158 10..163 149 30.2 Plus
vnc-PC 196 CG11989-PC 9..158 10..163 149 30.2 Plus
vnc-PD 196 CG11989-PD 9..158 10..163 149 30.2 Plus
vnc-PE 196 CG11989-PE 9..158 10..163 149 30.2 Plus
vnc-PA 196 CG11989-PA 9..158 10..163 149 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20771-PA 204 GI20771-PA 1..204 1..202 427 46.6 Plus
Dmoj\GI16318-PA 175 GI16318-PA 1..160 1..167 332 39.4 Plus
Dmoj\GI20782-PA 183 GI20782-PA 1..162 1..167 280 38.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26319-PA 203 GL26319-PA 1..188 1..194 403 42.9 Plus
Dper\GL27103-PA 175 GL27103-PA 1..160 1..167 344 40 Plus
Dper\GL23518-PA 178 GL23518-PA 1..160 1..167 341 40 Plus
Dper\GL26694-PA 182 GL26694-PA 1..164 1..167 313 41.6 Plus
Dper\GL12574-PA 160 GL12574-PA 4..155 5..164 151 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16524-PA 203 GA16524-PA 1..188 1..194 413 43.9 Plus
Dpse\GA22686-PA 175 GA22686-PA 1..160 1..167 344 40 Plus
Dpse\GA27286-PA 178 GA27286-PA 1..160 1..167 333 39.4 Plus
Dpse\GA16428-PA 182 GA16428-PA 1..164 1..167 311 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10355-PA 204 GM10355-PA 1..189 1..189 943 93.7 Plus
Dsec\GM25705-PA 162 GM25705-PA 1..152 1..155 230 37.9 Plus
Dsec\GM22725-PA 122 GM22725-PA 48..107 111..167 138 43.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23882-PA 204 GD23882-PA 1..189 1..189 931 92.1 Plus
Dsim\GD22076-PA 162 GD22076-PA 1..152 1..155 226 38.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17962-PA 178 GJ17962-PA 1..169 1..168 448 51.8 Plus
Dvir\GJ15656-PA 175 GJ15656-PA 1..160 1..167 343 40 Plus
Dvir\GJ17963-PA 184 GJ17963-PA 1..163 1..167 306 40.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19033-PA 196 GK19033-PA 1..183 1..190 430 43.7 Plus
Dwil\GK24995-PA 187 GK24995-PA 1..160 1..167 344 39.4 Plus
Dwil\GK15295-PA 227 GK15295-PA 1..158 1..166 313 38.7 Plus
Dwil\GK17457-PA 201 GK17457-PA 4..178 5..179 156 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18637-PA 204 GE18637-PA 1..204 1..204 865 78.9 Plus
Dyak\GE17370-PA 175 GE17370-PA 1..160 1..167 344 40 Plus
Dyak\GE11776-PA 157 GE11776-PA 1..147 1..155 244 37.6 Plus