Clone IP09896 Report

Search the DGRC for IP09896

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:98
Well:96
Vector:pOT2
Associated Gene/TranscriptCG32259-RC
Protein status:IP09896.pep: gold
Preliminary Size:858
Sequenced Size:804

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32259 2008-04-29 Release 5.5 accounting
CG32259 2008-04-29 Picked prior to 5.5
CG32259 2008-08-15 Release 5.9 accounting
CG32259 2008-12-18 5.12 accounting

Clone Sequence Records

IP09896.complete Sequence

804 bp (804 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023535

> IP09896.complete
CTGACCAACAGCTAATAGAATTATTCAGCAATTTTTGCAGAGAACGATTC
GATTCGATTTTGTGGGATTGCTAATTTTATTATCCAGCACGCTTGGAGAA
CTTGTGTTCGTTTACTTCATTTTCTGGATTGCAGTGAATTTTATTGGCTT
CGTCATTGTGCTTAACTATTTTGCAACTCTTCAGAAAGATGAATAAGATG
AACCCAAATCGTAGCAATAAGGATTCGGACACCACTGAGGATTCCAACGC
GAAGAAGAGTTTGCAAATGGATTCCGATTCATCAGACGTGTCGAAAGATT
ACTGTGATGGTTCAGATGAGAACGAGGAGTCCGACCCATCATCAGGTTCC
TCACAGGATTCGATAACTGAAAAATTAGCGAAAGCCATATTAGAGGCCAA
TCTAAGCGAGGACTCTGACTCTTCATCGGGTTCTTCAGAGCACTCTCCAG
CTCAAGAAATACCAATACCAGAAGCCTTGTTGGAAGTGGATCCAAATGAT
CAGCAGTCGGTTGTCAATGCAGTCGGACTTTTGGTTAACATGATTAACTC
CAAACTGGATGCTATCATGTCGAAAGTCGTCCCGCAATCACCACTTGATC
TTGTCGACCTCGTCCGCCAGAAAAAACTTTGGAAGATGCGTCAACGCGAT
AAAGCCCAGTTGAAGAAAAGCTCCGAATAGAATATTTTCTGTTCCTTTTC
CATTTTCGTACAATATTTCTTGTATCATGATTATAATAATGTTCAATTTA
TAGAGCAATTATAATTTCGAAGGGACGCTAAAAAAAAAAAAAAAAAAAAA
AAAA

IP09896.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32259-RD 995 CG32259-RD 37..816 1..780 3900 100 Plus
CG32259.b 851 CG32259.b 7..781 1..780 3800 99.3 Plus
CG32259.a 746 CG32259.a 70..715 135..780 3230 100 Plus
CG32259.a 746 CG32259.a 1..71 25..95 355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4069088..4069667 200..779 2900 100 Plus
chr3L 24539361 chr3L 4068920..4069026 94..200 535 100 Plus
chr3L 24539361 chr3L 4068755..4068847 1..93 465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4069702..4070282 200..780 2905 100 Plus
3L 28110227 3L 4069534..4069640 94..200 535 100 Plus
3L 28110227 3L 4069369..4069461 1..93 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4069702..4070282 200..780 2905 100 Plus
3L 28103327 3L 4069534..4069640 94..200 535 100 Plus
3L 28103327 3L 4069369..4069461 1..93 465 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:44:10 has no hits.

IP09896.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:45:00 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4068755..4068847 1..93 100 -> Plus
chr3L 4068920..4069026 94..200 100 -> Plus
chr3L 4069089..4069667 201..779 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:42 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RB 1..476 189..664 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:03 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RD 1..492 189..680 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:12 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RC 1..492 189..680 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:34 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RB 1..476 189..664 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:40 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RC 1..492 189..680 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:42:27 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RB 20..683 1..664 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:03 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RD 1..779 1..779 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:12 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RD 1..779 1..779 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:34 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RB 20..683 1..664 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:40 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
CG32259-RD 1..779 1..779 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:45:00 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4069369..4069461 1..93 100 -> Plus
3L 4069534..4069640 94..200 100 -> Plus
3L 4069703..4070281 201..779 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:45:00 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4069369..4069461 1..93 100 -> Plus
3L 4069534..4069640 94..200 100 -> Plus
3L 4069703..4070281 201..779 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:45:00 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4069369..4069461 1..93 100 -> Plus
3L 4069534..4069640 94..200 100 -> Plus
3L 4069703..4070281 201..779 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:12 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4069369..4069461 1..93 100 -> Plus
arm_3L 4069534..4069640 94..200 100 -> Plus
arm_3L 4069703..4070281 201..779 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:32 Download gff for IP09896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4069703..4070281 201..779 100   Plus
3L 4069369..4069461 1..93 100 -> Plus
3L 4069534..4069640 94..200 100 -> Plus

IP09896.pep Sequence

Translation from 188 to 679

> IP09896.pep
MNKMNPNRSNKDSDTTEDSNAKKSLQMDSDSSDVSKDYCDGSDENEESDP
SSGSSQDSITEKLAKAILEANLSEDSDSSSGSSEHSPAQEIPIPEALLEV
DPNDQQSVVNAVGLLVNMINSKLDAIMSKVVPQSPLDLVDLVRQKKLWKM
RQRDKAQLKKSSE*

IP09896.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15189-PA 170 GG15189-PA 1..134 1..152 252 45.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32259-PD 163 CG32259-PD 1..163 1..163 812 100 Plus
CG32259-PC 163 CG32259-PC 1..163 1..163 812 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14620-PA 228 GM14620-PA 1..154 1..158 481 75 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13809-PA 238 GD13809-PA 1..156 1..160 481 74.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21408-PA 201 GE21408-PA 2..167 7..157 292 46.7 Plus

IP09896.hyp Sequence

Translation from 188 to 679

> IP09896.hyp
MNKMNPNRSNKDSDTTEDSNAKKSLQMDSDSSDVSKDYCDGSDENEESDP
SSGSSQDSITEKLAKAILEANLSEDSDSSSGSSEHSPAQEIPIPEALLEV
DPNDQQSVVNAVGLLVNMINSKLDAIMSKVVPQSPLDLVDLVRQKKLWKM
RQRDKAQLKKSSE*

IP09896.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32259-PD 163 CG32259-PD 1..163 1..163 812 100 Plus
CG32259-PC 163 CG32259-PC 1..163 1..163 812 100 Plus