IP09896.complete Sequence
804 bp (804 high quality bases) assembled on 2005-06-08
GenBank Submission: BT023535
> IP09896.complete
CTGACCAACAGCTAATAGAATTATTCAGCAATTTTTGCAGAGAACGATTC
GATTCGATTTTGTGGGATTGCTAATTTTATTATCCAGCACGCTTGGAGAA
CTTGTGTTCGTTTACTTCATTTTCTGGATTGCAGTGAATTTTATTGGCTT
CGTCATTGTGCTTAACTATTTTGCAACTCTTCAGAAAGATGAATAAGATG
AACCCAAATCGTAGCAATAAGGATTCGGACACCACTGAGGATTCCAACGC
GAAGAAGAGTTTGCAAATGGATTCCGATTCATCAGACGTGTCGAAAGATT
ACTGTGATGGTTCAGATGAGAACGAGGAGTCCGACCCATCATCAGGTTCC
TCACAGGATTCGATAACTGAAAAATTAGCGAAAGCCATATTAGAGGCCAA
TCTAAGCGAGGACTCTGACTCTTCATCGGGTTCTTCAGAGCACTCTCCAG
CTCAAGAAATACCAATACCAGAAGCCTTGTTGGAAGTGGATCCAAATGAT
CAGCAGTCGGTTGTCAATGCAGTCGGACTTTTGGTTAACATGATTAACTC
CAAACTGGATGCTATCATGTCGAAAGTCGTCCCGCAATCACCACTTGATC
TTGTCGACCTCGTCCGCCAGAAAAAACTTTGGAAGATGCGTCAACGCGAT
AAAGCCCAGTTGAAGAAAAGCTCCGAATAGAATATTTTCTGTTCCTTTTC
CATTTTCGTACAATATTTCTTGTATCATGATTATAATAATGTTCAATTTA
TAGAGCAATTATAATTTCGAAGGGACGCTAAAAAAAAAAAAAAAAAAAAA
AAAA
IP09896.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:35:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32259-RD | 995 | CG32259-RD | 37..816 | 1..780 | 3900 | 100 | Plus |
CG32259.b | 851 | CG32259.b | 7..781 | 1..780 | 3800 | 99.3 | Plus |
CG32259.a | 746 | CG32259.a | 70..715 | 135..780 | 3230 | 100 | Plus |
CG32259.a | 746 | CG32259.a | 1..71 | 25..95 | 355 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:44:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 4069088..4069667 | 200..779 | 2900 | 100 | Plus |
chr3L | 24539361 | chr3L | 4068920..4069026 | 94..200 | 535 | 100 | Plus |
chr3L | 24539361 | chr3L | 4068755..4068847 | 1..93 | 465 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:44:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 4069702..4070282 | 200..780 | 2905 | 100 | Plus |
3L | 28110227 | 3L | 4069534..4069640 | 94..200 | 535 | 100 | Plus |
3L | 28110227 | 3L | 4069369..4069461 | 1..93 | 465 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 4069702..4070282 | 200..780 | 2905 | 100 | Plus |
3L | 28103327 | 3L | 4069534..4069640 | 94..200 | 535 | 100 | Plus |
3L | 28103327 | 3L | 4069369..4069461 | 1..93 | 465 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 03:44:10 has no hits.
IP09896.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:45:00 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 4068755..4068847 | 1..93 | 100 | -> | Plus |
chr3L | 4068920..4069026 | 94..200 | 100 | -> | Plus |
chr3L | 4069089..4069667 | 201..779 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:42 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RB | 1..476 | 189..664 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:03 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RD | 1..492 | 189..680 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:12 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RC | 1..492 | 189..680 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:34 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RB | 1..476 | 189..664 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:40 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RC | 1..492 | 189..680 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:42:27 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RB | 20..683 | 1..664 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:03 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RD | 1..779 | 1..779 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:12 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RD | 1..779 | 1..779 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:34 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RB | 20..683 | 1..664 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:40 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32259-RD | 1..779 | 1..779 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:45:00 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4069369..4069461 | 1..93 | 100 | -> | Plus |
3L | 4069534..4069640 | 94..200 | 100 | -> | Plus |
3L | 4069703..4070281 | 201..779 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:45:00 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4069369..4069461 | 1..93 | 100 | -> | Plus |
3L | 4069534..4069640 | 94..200 | 100 | -> | Plus |
3L | 4069703..4070281 | 201..779 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:45:00 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4069369..4069461 | 1..93 | 100 | -> | Plus |
3L | 4069534..4069640 | 94..200 | 100 | -> | Plus |
3L | 4069703..4070281 | 201..779 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:12 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 4069369..4069461 | 1..93 | 100 | -> | Plus |
arm_3L | 4069534..4069640 | 94..200 | 100 | -> | Plus |
arm_3L | 4069703..4070281 | 201..779 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:32 Download gff for
IP09896.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4069703..4070281 | 201..779 | 100 | | Plus |
3L | 4069369..4069461 | 1..93 | 100 | -> | Plus |
3L | 4069534..4069640 | 94..200 | 100 | -> | Plus |
IP09896.pep Sequence
Translation from 188 to 679
> IP09896.pep
MNKMNPNRSNKDSDTTEDSNAKKSLQMDSDSSDVSKDYCDGSDENEESDP
SSGSSQDSITEKLAKAILEANLSEDSDSSSGSSEHSPAQEIPIPEALLEV
DPNDQQSVVNAVGLLVNMINSKLDAIMSKVVPQSPLDLVDLVRQKKLWKM
RQRDKAQLKKSSE*
IP09896.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:52:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15189-PA | 170 | GG15189-PA | 1..134 | 1..152 | 252 | 45.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32259-PD | 163 | CG32259-PD | 1..163 | 1..163 | 812 | 100 | Plus |
CG32259-PC | 163 | CG32259-PC | 1..163 | 1..163 | 812 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:52:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14620-PA | 228 | GM14620-PA | 1..154 | 1..158 | 481 | 75 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:52:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13809-PA | 238 | GD13809-PA | 1..156 | 1..160 | 481 | 74.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:52:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21408-PA | 201 | GE21408-PA | 2..167 | 7..157 | 292 | 46.7 | Plus |
IP09896.hyp Sequence
Translation from 188 to 679
> IP09896.hyp
MNKMNPNRSNKDSDTTEDSNAKKSLQMDSDSSDVSKDYCDGSDENEESDP
SSGSSQDSITEKLAKAILEANLSEDSDSSSGSSEHSPAQEIPIPEALLEV
DPNDQQSVVNAVGLLVNMINSKLDAIMSKVVPQSPLDLVDLVRQKKLWKM
RQRDKAQLKKSSE*
IP09896.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32259-PD | 163 | CG32259-PD | 1..163 | 1..163 | 812 | 100 | Plus |
CG32259-PC | 163 | CG32259-PC | 1..163 | 1..163 | 812 | 100 | Plus |