Clone IP09901 Report

Search the DGRC for IP09901

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:1
Vector:pOT2
Associated Gene/TranscriptCG42635-RA
Protein status:IP09901.pep: gold
Preliminary Size:765
Sequenced Size:1048

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15149 2005-01-01 Successful iPCR screen
CG15149 2008-04-29 Release 5.5 accounting

Clone Sequence Records

IP09901.complete Sequence

1048 bp (1048 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023226

> IP09901.complete
ATCAGGTCGCAAATTGTGTGAAAATAGTTTTCTAAATTCAAAATTCAAGT
CTCTTGGTCATGTCCTCGTCTGTGGATCACGTGGTACACCACGTACTGGC
CCCAATGGCAATCAACGTCCTCGATCGCGTGGTGCCAGTAATCCGCCAAT
TGGTGATCATCATGCATCAGGCATTTCTGGTTGATCACCATGTGTCGGAG
CCCGTGATCGATGTATCCGGCATGATTCAGCCCGTTCGTAAAATAGTCTT
GATTGTAAACGATTCAACGCCGGAGCACCATGTCGACCAGGAGCAGGTGG
TCAGTTCGGATGACATTAACTACCTGATAAATGAAATTTCGCGAAGTATC
CGAAACTTGGCCCGTTCGACCTATAATACCATCTCGGCGATGGCTGGAGA
GTAGCCCTAGAATTATTTGTCATCGTGGTCGATCGAAAAATCCGACATCG
ACCCTCCTGATCCTCCAGAAGATCCTGCTCCTTTGCCCAAGATATGGAAA
TGGTTCACACGGCCATCGGAGTTGCGGGCATAGTGGCCCTGTTTATGGTA
GTTTCCCGTTCGTTAACTGAAGTGGGTGGCAGGGTGTTAAACCAAACCCG
TGATCCGATCGCTGACCTTGTGAGGCGCGGTGGTCCAGTGGCGGATCAGC
TGTCCGCCGTCGAGGGCGAAACTCCTCTAGTAGAGGGCGATCGCATGGAT
GGCGCCTGCTCCGTGGTACAAAGTATTGGAGGCAAGGCATGTGCCTTTGT
AGGACCATTGCTTCCTAAGTTTGGCAGTGAACATAATTCCGAGGGCTCCT
CCAAGGAAGACGAAAAGGATAAAAAGGACTCGGAACCGGTAGTAGTAAAA
CCTGAAACACCGCCAGCGGCAGAATTAACCGAAGAGGAGTAGGATCTAGT
CAGCAACTATGTCGAATAGAAAGCAAAAAAAAGGAAATTTTTAGTTTTCT
CTAGTTGGCCTTGGAAATAAACTTCACTCATCTTGTGGGCTTTGTGGGAT
TCGAAACCTAGAGAGCTCATTCATTTTGAAAAAAAAAAAAAAAAAAAA

IP09901.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42635-RA 1028 CG42635-RA 1..1028 1..1028 5140 100 Plus
CG42634-RA 1028 CG42634-RA 1..1028 1..1028 5140 100 Plus
CG31740-RA 771 CG31740-RA 1..177 854..1030 885 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18006580..18007607 1..1028 5125 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:59:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007935..18008964 1..1030 5150 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007935..18008964 1..1030 5150 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:46:29 has no hits.

IP09901.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:47:46 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18006580..18007607 1..1028 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:43 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15149-RA 1..334 60..393 100 == Plus
CG15149-RA 335..765 463..892 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:39 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..399 494..892 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:46:21 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..399 494..892 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:01:57 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15149-RA 1..334 60..393 100 == Plus
CG15149-RA 335..765 463..892 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:57 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RB 1..399 494..892 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:17:16 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15149-RA 1..334 60..393 100 == Plus
CG15149-RA 335..765 463..892 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:39 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:46:21 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:01:58 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG15149-RA 1..334 60..393 100 == Plus
CG15149-RA 335..765 463..892 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:57 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
CG42634-RA 1..1028 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:46 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:46 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:46 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:46:21 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:46 Download gff for IP09901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus

IP09901.pep Sequence

Translation from 493 to 891

> IP09901.pep
MEMVHTAIGVAGIVALFMVVSRSLTEVGGRVLNQTRDPIADLVRRGGPVA
DQLSAVEGETPLVEGDRMDGACSVVQSIGGKACAFVGPLLPKFGSEHNSE
GSSKEDEKDKKDSEPVVVKPETPPAAELTEEE*

IP09901.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14809-PA 259 GF14809-PA 123..240 1..114 270 50.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21100-PA 254 GG21100-PA 123..254 1..132 567 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42635-PA 132 CG42635-PA 1..132 1..132 668 100 Plus
CG42635-PB 132 CG42635-PB 1..132 1..132 668 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17257-PA 254 GM17257-PA 123..254 1..132 640 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24122-PA 200 GD24122-PA 69..200 1..132 639 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12804-PA 254 GE12804-PA 123..254 1..132 546 81.8 Plus

IP09901.hyp Sequence

Translation from 493 to 891

> IP09901.hyp
MEMVHTAIGVAGIVALFMVVSRSLTEVGGRVLNQTRDPIADLVRRGGPVA
DQLSAVEGETPLVEGDRMDGACSVVQSIGGKACAFVGPLLPKFGSEHNSE
GSSKEDEKDKKDSEPVVVKPETPPAAELTEEE*

IP09901.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG42635-PA 132 CG42635-PA 1..132 1..132 668 100 Plus
CG42635-PB 132 CG42635-PB 1..132 1..132 668 100 Plus