Clone IP09907 Report

Search the DGRC for IP09907

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:7
Vector:pOT2
Associated Gene/TranscriptCG15283-RB
Protein status:IP09907.pep: gold
Preliminary Size:877
Sequenced Size:661

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15283 2008-04-29 Release 5.5 accounting

Clone Sequence Records

IP09907.complete Sequence

661 bp (661 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023534

> IP09907.complete
AAATTGTTTAGCTAATCCCAAATCTGTAACACATTTTACCAGCCCAAAAA
TAAAGACCCCAAATGATTAGATCCTGTCGAGCTCTGATCTCCCAGTGCGG
ATTACACCTAAGACGATGTTCTCTTGCAAAGGCAGCAAGTAATTTGAAAA
AAGATGATGTCGAAGAAATGGAAACACCAGCGAATAGACAGAGGGTTGAG
CTGCCACCGAATCCCGAGGAAAAACTAAGTAAGCGCTATCTTGCGTTCCG
GGAAAAGCTGCGATCGGAGGCGCCGCTAGAACCACTGCCCGAGTGTGCAC
CACATCCGGCCCACGAAAAGGAGCCACTTAAACCGTGGCCCAATAATACC
AATCCGTATACCGGGGAAATCGGTGGACAAGCGGGACCAGAACCCACGCG
CTATGGCGACTGGGAGCGCAAGGGACGAGTCACGGATTTCTGAGCGAAGT
CATATCTTCACCTCGACACCTTTTTGTTTGGACAATTGTGATTTATTAAC
CGTGTTAACAACAGAAGCACTCACAATTTGTTACGCTGCCGATGGGCGAG
GAAAACTGTGCGCTACAGTAGCCACGGAATCCAGATCAAGATGAGTAAAA
TTCAGATACCCAGCAGTGCTGCTTCTGCGAAGGCATTACATAAAAAAAAA
AAAAAAAAAAA

IP09907.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-RB 641 CG15283-RB 1..641 1..641 3205 100 Plus
CG7224.d 587 CG7224.d 230..369 302..441 340 82.8 Plus
CG7224.a 754 CG7224.a 397..536 302..441 340 82.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14449025..14449665 641..1 3205 100 Minus
chr2L 23010047 chr2L 7998428..7998567 302..441 340 82.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14450279..14450922 644..1 3220 100 Minus
2L 23513712 2L 7999409..7999548 302..441 340 82.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14450279..14450922 644..1 3220 100 Minus
2L 23513712 2L 7999409..7999548 302..441 340 82.8 Plus
Blast to na_te.dros performed on 2019-03-16 10:09:27 has no hits.

IP09907.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:10:20 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14449025..14449665 1..641 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:48 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RA 1..261 168..428 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:58:30 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 1..381 63..443 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:49 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 1..381 63..443 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:36 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RA 1..261 168..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:37 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 1..381 63..443 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:42:30 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RA 1..322 107..428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:58:30 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:49 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:36 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RA 1..322 107..428 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:37 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 1..641 1..641 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:20 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14450282..14450922 1..641 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:20 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14450282..14450922 1..641 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:20 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14450282..14450922 1..641 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:49 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14450282..14450922 1..641 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:58 Download gff for IP09907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14450282..14450922 1..641 100   Minus

IP09907.pep Sequence

Translation from 62 to 442

> IP09907.pep
MIRSCRALISQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPN
PEEKLSKRYLAFREKLRSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYT
GEIGGQAGPEPTRYGDWERKGRVTDF*

IP09907.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15011-PA 127 GF15011-PA 1..127 1..126 356 58.5 Plus
Dana\GF14571-PA 118 GF14571-PA 4..118 1..126 295 48.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24253-PA 93 GG24253-PA 1..93 36..126 439 93.5 Plus
Dere\GG10505-PA 118 GG10505-PA 4..118 1..126 292 48.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13408-PA 119 GH13408-PA 1..119 8..126 283 50.8 Plus
Dgri\GH10282-PA 119 GH10282-PA 43..119 46..126 283 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-PB 126 CG15283-PB 1..126 1..126 688 100 Plus
Sirup-PC 118 CG7224-PC 48..118 56..126 289 70.4 Plus
Sirup-PA 118 CG7224-PA 48..118 56..126 289 70.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15767-PA 118 GI15767-PA 15..118 21..126 295 54.7 Plus
Dmoj\GI17647-PA 118 GI17647-PA 48..118 56..126 294 77.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25766-PA 195 GL25766-PA 81..195 13..126 352 61.7 Plus
Dper\GL19610-PA 118 GL19610-PA 7..118 3..126 276 48.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13625-PA 225 GA13625-PA 131..225 33..126 346 69.5 Plus
Dpse\GA20193-PA 118 GA20193-PA 7..118 3..126 277 48.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14795-PA 142 GM14795-PA 1..87 36..122 453 98.9 Plus
Dsec\GM16654-PA 118 GM16654-PA 4..118 1..126 288 47.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22004-PA 142 GD22004-PA 1..87 36..122 453 98.9 Plus
Dsim\GD23496-PA 118 GD23496-PA 4..118 1..126 291 48.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18212-PA 110 GJ18212-PA 36..110 52..126 311 76 Plus
Dvir\GJ10242-PA 112 GJ10242-PA 35..112 45..126 287 67.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18895-PA 82 GK18895-PA 12..82 56..126 320 85.9 Plus
Dwil\GK15130-PA 117 GK15130-PA 47..117 56..126 283 69 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24984-PA 126 GE24984-PA 1..126 1..126 602 89.7 Plus
Dyak\GE18724-PA 120 GE18724-PA 6..120 3..126 281 46.9 Plus

IP09907.hyp Sequence

Translation from 62 to 442

> IP09907.hyp
MIRSCRALISQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPN
PEEKLSKRYLAFREKLRSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYT
GEIGGQAGPEPTRYGDWERKGRVTDF*

IP09907.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-PB 126 CG15283-PB 1..126 1..126 688 100 Plus
Sirup-PC 118 CG7224-PC 48..118 56..126 289 70.4 Plus
Sirup-PA 118 CG7224-PA 48..118 56..126 289 70.4 Plus