Clone IP09919 Report

Search the DGRC for IP09919

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:19
Vector:pOT2
Associated Gene/TranscriptCG15602-RA
Protein status:IP09919.pep: gold
Preliminary Size:927
Sequenced Size:1171

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15602 2008-04-29 Release 5.5 accounting
CG15602 2008-08-15 Release 5.9 accounting
CG15602 2008-12-18 5.12 accounting

Clone Sequence Records

IP09919.complete Sequence

1171 bp (1171 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023531

> IP09919.complete
AGCAAACGAAATTTGAAACTTTTTCAATTTATATGTTCCATTGGTGACTC
TGGTTGCAATGAGCTGCTTTGGCTGCGGTCGCAAATATGGCCTATTCTGC
AAGGAGTATGGATGCCCCAACTGCGGCTACTCATTCTGCTCCAAGTGCTT
GAAGAGACCAATGCCCGTGCCCCGTCATGCAGGAAAGGTGCACAATGTGT
GCCTCATATGCTACGACAAACTATCCAAACTCCAGGCGAGCGCCGATGCC
GAGAAAGTTATAGACTGTGATGCTTTGCCGGGGATCTTAGTCACCAAAAT
GAACCTGGCTCCTCCATCCAAAAGTTCAGATGGCGCCGATGCCCTATTCA
ACGACAGCCTGCCTGTGGAGGAGCTGCCACAGGCATTGGTTCCCAGTTCC
AGTTCGTCACCACATTCCAAAGATCACAAGGATCATATTGATGAGAACCT
GGACAGTGAGTTGACCAAACGAATGCAGGACTATAAACGAGTTGATGCCA
CCGATGATGAGATCCGCACCCGTCTGGCCAATCTCACTGGGATGCCGCAT
ACGAAAAGCTACGATAAGAAAGATCTGCTACTGTCCACCGACCAAAGAAA
CGATCAGGAGAAAATGAGGGACTTGCTCGCACAATTCGTTGACGAAGCCC
AACTGGATCAAAATATCAGCAGGCAGAGGGATGACTCAATTTCCGACATT
GAGAGACGTCTGCGAGCTCTGCGCGATACACCCGTCGATTCCGATGCATG
CCCATCGAGATCCCAGATGGAAAGTATCGCGGACAACGAAGAGGATGACG
AGACACTTCTACAGAACATATTGAAAAAGTATGTAGCAGAATCGCGCTTA
CCAGAACCTTCCGAGAGTGAAATTAGTCCAATTAACACTGAGTCGCCCGG
CAACACCGAAGAATTGCCCTGGTGCAATATTTGTAACGAAGACGCCGACT
TCCGATGCCACGGATGTGGTGGGGAACTCTTTTGCACTCTATGCTATAAG
GAGTGCCACGATGATGACGAGGAGTACCGTGCTCACGTTAAGGAAAAGTA
TTCGGCTCCGCCAAAGCTTAAAGAAAATCACTTCTAATTGTTAATTGTTT
ACTTGACTGTACGCAAATTTTTGTTTAATTATAGATTGTTTTCAGCAAAT
GCAAAAAAAAAAAAAAAAAAA

IP09919.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG15602-RA 1418 CG15602-RA 230..1382 1..1153 5765 100 Plus
CG15602.a 1116 CG15602.a 68..1116 105..1153 5245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15689955..15690432 352..829 2390 100 Plus
chrX 22417052 chrX 15690496..15690820 828..1152 1625 100 Plus
chrX 22417052 chrX 15689650..15689896 105..351 1235 100 Plus
chrX 22417052 chrX 15689475..15689580 1..106 530 100 Plus
chrX 22417052 chrX 15686359..15686427 1..69 300 95.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15800096..15800573 352..829 2390 100 Plus
X 23542271 X 15800637..15800962 828..1153 1630 100 Plus
X 23542271 X 15799791..15800037 105..351 1235 100 Plus
X 23542271 X 15799616..15799721 1..106 530 100 Plus
X 23542271 X 15796500..15796568 1..69 300 95.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15808194..15808671 352..829 2390 100 Plus
X 23527363 X 15808735..15809060 828..1153 1630 100 Plus
X 23527363 X 15807889..15808135 105..351 1235 100 Plus
X 23527363 X 15807714..15807819 1..106 530 100 Plus
X 23527363 X 15804598..15804666 1..69 300 95.6 Plus
Blast to na_te.dros performed 2019-03-16 08:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1781..1824 1042..999 112 72.7 Minus

IP09919.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:09:27 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15690498..15690820 830..1152 100   Plus
chrX 15689475..15689580 1..106 100 -> Plus
chrX 15689652..15689896 107..351 100 -> Plus
chrX 15689955..15690432 352..829 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:43:50 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 1..1029 59..1087 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:00:04 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 1..1029 59..1087 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:45 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 1..1029 59..1087 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:37 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 1..1029 59..1087 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:16 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 1..1029 59..1087 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:42:33 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 21..1172 1..1152 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:00:04 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 21..1172 1..1152 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:45 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 21..1172 1..1152 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:37 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 21..1172 1..1152 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:16 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
CG15602-RA 21..1172 1..1152 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:27 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
X 15799616..15799721 1..106 100 -> Plus
X 15799793..15800037 107..351 100 -> Plus
X 15800096..15800573 352..829 100 -> Plus
X 15800639..15800961 830..1152 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:27 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
X 15799616..15799721 1..106 100 -> Plus
X 15799793..15800037 107..351 100 -> Plus
X 15800096..15800573 352..829 100 -> Plus
X 15800639..15800961 830..1152 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:27 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
X 15799616..15799721 1..106 100 -> Plus
X 15799793..15800037 107..351 100 -> Plus
X 15800096..15800573 352..829 100 -> Plus
X 15800639..15800961 830..1152 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:45 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15693649..15693754 1..106 100 -> Plus
arm_X 15693826..15694070 107..351 100 -> Plus
arm_X 15694129..15694606 352..829 100 -> Plus
arm_X 15694672..15694994 830..1152 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:33 Download gff for IP09919.complete
Subject Subject Range Query Range Percent Splice Strand
X 15807891..15808135 107..351 100 -> Plus
X 15808194..15808671 352..829 100 -> Plus
X 15808737..15809059 830..1152 100   Plus
X 15807714..15807819 1..106 100 -> Plus

IP09919.hyp Sequence

Translation from 58 to 1086

> IP09919.hyp
MSCFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHAGKVHNVCLI
CYDKLSKLQASADAEKVIDCDALPGILVTKMNLAPPSKSSDGADALFNDS
LPVEELPQALVPSSSSSPHSKDHKDHIDENLDSELTKRMQDYKRVDATDD
EIRTRLANLTGMPHTKSYDKKDLLLSTDQRNDQEKMRDLLAQFVDEAQLD
QNISRQRDDSISDIERRLRALRDTPVDSDACPSRSQMESIADNEEDDETL
LQNILKKYVAESRLPEPSESEISPINTESPGNTEELPWCNICNEDADFRC
HGCGGELFCTLCYKECHDDDEEYRAHVKEKYSAPPKLKENHF*

IP09919.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15602-PB 342 CG15602-PB 1..342 1..342 1844 100 Plus
CG15602-PA 342 CG15602-PA 1..342 1..342 1844 100 Plus

IP09919.pep Sequence

Translation from 58 to 1086

> IP09919.pep
MSCFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHAGKVHNVCLI
CYDKLSKLQASADAEKVIDCDALPGILVTKMNLAPPSKSSDGADALFNDS
LPVEELPQALVPSSSSSPHSKDHKDHIDENLDSELTKRMQDYKRVDATDD
EIRTRLANLTGMPHTKSYDKKDLLLSTDQRNDQEKMRDLLAQFVDEAQLD
QNISRQRDDSISDIERRLRALRDTPVDSDACPSRSQMESIADNEEDDETL
LQNILKKYVAESRLPEPSESEISPINTESPGNTEELPWCNICNEDADFRC
HGCGGELFCTLCYKECHDDDEEYRAHVKEKYSAPPKLKENHF*

IP09919.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17917-PA 308 GG17917-PA 1..308 35..342 1499 91.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12533-PA 359 GH12533-PA 1..359 1..342 1114 60.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15602-PB 342 CG15602-PB 1..342 1..342 1844 100 Plus
CG15602-PA 342 CG15602-PA 1..342 1..342 1844 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11195-PA 361 GI11195-PA 1..361 1..342 1106 59.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18057-PA 353 GL18057-PA 22..353 17..342 1022 60.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22586-PA 309 GM22586-PA 1..309 35..342 1470 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24679-PA 313 GD24679-PA 1..313 35..342 1454 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18478-PA 358 GJ18478-PA 1..358 1..342 1138 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25124-PA 365 GK25124-PA 1..365 1..342 1193 64.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17225-PA 308 GE17225-PA 1..308 35..342 1448 92.2 Plus