Clone IP09932 Report

Search the DGRC for IP09932

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:32
Vector:pOT2
Associated Gene/TranscripteloF-RA
Protein status:IP09932.pep: gold
Preliminary Size:781
Sequenced Size:1005

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16905 2008-04-29 Release 5.5 accounting
CG16905 2008-08-15 Release 5.9 accounting
eloF 2008-12-18 5.12 accounting

Clone Sequence Records

IP09932.complete Sequence

1005 bp (1005 high quality bases) assembled on 2006-02-24

GenBank Submission: BT024993

> IP09932.complete
CACAACTCGATTAGATTCGCCATGTTCGCTCCGATAGATCCTGTAAAGAT
ACCCGTTGTAAGCAATCCATGGATAACCATGGGCACATTGATTGGCTATC
TGCTGTTTGTGCTCAAGCTGGGCCCCAAAATCATGGAGCACCGAAAGCCC
TTCCATTTGAATGGCGTCATCAGGATCTACAACATATTCCAGATCCTTTA
CAATGGTCTAATACTCGTTTTAGGAGTTCACTTCCTGTTTGTCCTGAAAG
CCTACCAAATCAGTTGCATTGTTAGCCTGCCGATGGATCACAAATATAAG
GATAGAGAGCGTTTGATTTGCACTTTGTACCTGGTGAACAAATTCGTAGA
CCTTGTGGAAACCATTTTCTTTGTGCTCCGCAAAAAGGACAGACAGATAT
CCTTCCTGCACGTCTTCCATCATTTTGCGATGGCATTTTTTGGATATCTC
TACTACTGCTTCCACGGATACGGTGGCGTTGCCTTTCCACAGTGCCTGCT
AAACACCGCCGTCCACGTGATTATGTACGCCTACTACTATCTATCCTCGA
TCAGCAAGGAGGTGCAGAGAAGTCTCTGGTGGAAGAAATACATCACAATT
GCTCAGCTGGTCCAGTTCGCCATTATTCTGCTCCACTGTACCATCACGCT
GGCACAGCCCAACTGCGCGGTCAACAGACCCTTGACCTACGGATGCGGAT
CGCTTTCAGCGTTTTTTGCAGTGATATTTAGCCAATTTTATTACCACAAC
TACATAAAGCCAGGAAAGAAGTCAGCGAAACAAAACAAAAATTAACTAAA
TTTAAACTAAATCATGAGTACAAAGCCTAAAGATTCGTGAAGCAACAATA
GCCACAGCCTATTTTTGAATATTTCATATATGATTTTATGGGGTAAATGA
ATTAAAAAACATTTGTTTTCTTGGCGTCAAACTAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

IP09932.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
eloF-RA 1075 eloF-RA 142..1075 1..934 4670 100 Plus
CG8534-RA 1283 CG8534-RA 743..847 511..618 275 85.1 Plus
CG8534-RA 1283 CG8534-RA 599..651 367..419 190 90.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5640267..5640977 223..933 3525 99.7 Plus
chr3R 27901430 chr3R 5639980..5640202 1..223 1100 99.6 Plus
chr3R 27901430 chr3R 5639196..5639444 367..618 355 77 Plus
chr3R 27901430 chr3R 18383332..18383398 422..356 185 85.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9814448..9815159 223..934 3560 100 Plus
3R 32079331 3R 9814161..9814383 1..223 1115 100 Plus
3R 32079331 3R 9813377..9813625 367..618 355 77 Plus
3R 32079331 3R 22559794..22559860 422..356 185 85.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9555279..9555990 223..934 3560 100 Plus
3R 31820162 3R 9554992..9555214 1..223 1115 100 Plus
3R 31820162 3R 9554352..9554456 511..618 275 85.1 Plus
3R 31820162 3R 9554208..9554260 367..419 190 90.5 Plus
3R 31820162 3R 9560207..9560262 422..367 175 87.5 Minus
3R 31820162 3R 9558511..9558552 614..573 150 90.4 Minus
Blast to na_te.dros performed 2019-03-15 22:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1201..1262 918..860 123 69.4 Minus
TAHRE 10463 TAHRE OSV 10463bp 8493..8548 779..835 110 72.4 Plus

IP09932.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:15:49 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5639980..5640201 1..222 99 -> Plus
chr3R 5640267..5640977 223..933 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:44:04 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..774 22..795 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:16:03 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..774 22..795 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:12:48 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..774 22..795 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:30 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
CG16905-RA 1..774 22..795 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:53 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..774 22..795 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:42 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..933 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:16:03 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..933 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:12:48 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..933 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:31 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
CG16905-RA 1..933 1..933 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:53 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
eloF-RA 1..933 1..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:49 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9814161..9814382 1..222 100 -> Plus
3R 9814448..9815158 223..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:49 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9814161..9814382 1..222 100 -> Plus
3R 9814448..9815158 223..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:49 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9814161..9814382 1..222 100 -> Plus
3R 9814448..9815158 223..933 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:12:48 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5639883..5640104 1..222 100 -> Plus
arm_3R 5640170..5640880 223..933 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:36:04 Download gff for IP09932.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9554992..9555213 1..222 100 -> Plus
3R 9555279..9555989 223..933 100   Plus

IP09932.hyp Sequence

Translation from 0 to 794

> IP09932.hyp
HNSIRFAMFAPIDPVKIPVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKP
FHLNGVIRIYNIFQILYNGLILVLGVHFLFVLKAYQISCIVSLPMDHKYK
DRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFGYL
YYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITI
AQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHN
YIKPGKKSAKQNKN*

IP09932.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
eloF-PA 257 CG16905-PA 1..257 8..264 1373 100 Plus
CG8534-PA 265 CG8534-PA 14..264 13..264 793 59.1 Plus
CG9458-PA 264 CG9458-PA 12..262 10..260 679 49.4 Plus
CG16904-PA 262 CG16904-PA 11..262 13..264 670 48.4 Plus
CG9459-PA 265 CG9459-PA 12..262 10..259 617 48 Plus

IP09932.pep Sequence

Translation from 21 to 794

> IP09932.pep
MFAPIDPVKIPVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVI
RIYNIFQILYNGLILVLGVHFLFVLKAYQISCIVSLPMDHKYKDRERLIC
TLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFGYLYYCFHGY
GGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFA
IILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKK
SAKQNKN*

IP09932.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15497-PA 253 GF15497-PA 1..250 1..250 759 56.8 Plus
Dana\GF15498-PA 253 GF15498-PA 1..253 1..253 750 56.1 Plus
Dana\GF13996-PA 269 GF13996-PA 5..259 3..257 689 51.4 Plus
Dana\GF15499-PA 244 GF15499-PA 1..244 1..256 661 54.3 Plus
Dana\GF22463-PA 260 GF22463-PA 1..253 1..253 630 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17214-PA 265 GG17214-PA 14..261 6..253 752 57.4 Plus
Dere\GG17320-PA 260 GG17320-PA 11..260 6..255 684 52 Plus
Dere\GG17318-PA 264 GG17318-PA 12..262 3..253 580 48.6 Plus
Dere\GG20950-PA 263 GG20950-PA 11..263 6..257 533 43.1 Plus
Dere\GG17319-PA 264 GG17319-PA 12..261 3..252 533 45.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22831-PA 416 GH22831-PA 186..416 26..256 551 46.3 Plus
Dgri\GH19804-PA 261 GH19804-PA 11..261 6..255 465 37.5 Plus
Dgri\GH19803-PA 217 GH19803-PA 1..217 38..255 389 39.3 Plus
Dgri\GH22831-PA 416 GH22831-PA 13..181 8..176 388 44.4 Plus
Dgri\GH17398-PA 285 GH17398-PA 43..264 23..246 377 40.8 Plus
Dgri\GH18331-PA 339 GH18331-PA 56..306 6..256 365 35 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
eloF-PA 257 CG16905-PA 1..257 1..257 1373 100 Plus
CG8534-PA 265 CG8534-PA 14..264 6..257 793 59.1 Plus
CG9458-PA 264 CG9458-PA 12..262 3..253 679 49.4 Plus
CG16904-PA 262 CG16904-PA 11..262 6..257 670 48.4 Plus
CG9459-PA 265 CG9459-PA 12..262 3..252 617 48 Plus
CG18609-PA 263 CG18609-PA 11..263 6..255 560 43.9 Plus
CG31141-PA 253 CG31141-PA 11..251 6..250 533 42 Plus
CG17821-PA 262 CG17821-PA 13..260 4..250 513 40.3 Plus
CG6660-PA 272 CG6660-PA 24..266 10..253 390 34.9 Plus
CG5326-PA 277 CG5326-PA 46..271 26..253 390 39.6 Plus
bond-PC 322 CG6921-PC 28..259 12..246 376 35.8 Plus
bond-PA 322 CG6921-PA 28..259 12..246 376 35.8 Plus
bond-PB 322 CG6921-PB 28..259 12..246 376 35.8 Plus
sit-PA 295 CG5278-PA 29..266 12..256 372 35.9 Plus
CG2781-PA 329 CG2781-PA 27..272 11..257 370 34.3 Plus
CG33110-PA 337 CG33110-PA 59..300 9..254 364 33.6 Plus
CG31522-PF 365 CG31522-PF 27..258 11..244 359 34.5 Plus
CG31522-PB 365 CG31522-PB 27..258 11..244 359 34.5 Plus
CG31522-PD 365 CG31522-PD 27..258 11..244 359 34.5 Plus
CG31522-PH 364 CG31522-PH 27..257 11..244 351 33.3 Plus
CG31522-PG 364 CG31522-PG 27..257 11..244 351 33.3 Plus
CG31522-PA 364 CG31522-PA 27..257 11..244 351 33.3 Plus
CG31523-PF 354 CG31523-PF 29..264 12..250 330 31.7 Plus
CG31523-PE 354 CG31523-PE 29..264 12..250 330 31.7 Plus
CG31523-PG 354 CG31523-PG 29..264 12..250 330 31.7 Plus
CG31523-PD 354 CG31523-PD 29..264 12..250 330 31.7 Plus
CG31523-PA 354 CG31523-PA 29..264 12..250 330 31.7 Plus
CG31523-PB 354 CG31523-PB 29..264 12..250 330 31.7 Plus
CG31523-PC 354 CG31523-PC 29..264 12..250 330 31.7 Plus
CG31522-PI 392 CG31522-PI 27..285 11..244 330 30.6 Plus
Elo68beta-PB 269 CG11801-PB 30..259 11..244 312 34.2 Plus
Elo68alpha-PA 262 CG32072-PA 23..252 11..244 289 30.8 Plus
CG30008-PA 266 CG30008-PA 13..257 8..257 286 31.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10225-PA 258 GI10225-PA 9..258 4..253 562 43.6 Plus
Dmoj\GI10223-PA 260 GI10223-PA 8..260 3..255 534 42.5 Plus
Dmoj\GI20345-PA 249 GI20345-PA 6..249 11..253 498 40.6 Plus
Dmoj\GI20344-PA 262 GI20344-PA 17..256 9..247 483 38.8 Plus
Dmoj\GI20347-PA 245 GI20347-PA 1..244 11..254 472 42 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23223-PA 262 GL23223-PA 11..258 6..253 645 48 Plus
Dper\GL23222-PA 264 GL23222-PA 9..262 4..255 642 50.6 Plus
Dper\GL11311-PA 284 GL11311-PA 12..254 6..247 490 42.4 Plus
Dper\GL11310-PA 263 GL11310-PA 14..262 4..251 466 41.8 Plus
Dper\GL13683-PA 277 GL13683-PA 43..271 23..253 377 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21802-PA 264 GA21802-PA 9..262 4..255 646 50.6 Plus
Dpse\GA14209-PA 262 GA14209-PA 11..258 6..253 643 47.2 Plus
Dpse\GA15013-PA 286 GA15013-PA 12..254 6..247 490 42.4 Plus
Dpse\GA14683-PA 263 GA14683-PA 14..262 4..251 467 41.8 Plus
Dpse\GA18806-PA 277 GA18806-PA 43..271 23..253 377 39.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23846-PA 258 GM23846-PA 1..255 1..255 1243 91 Plus
Dsec\GM23845-PA 265 GM23845-PA 14..264 6..257 787 58.7 Plus
Dsec\GM26206-PA 262 GM26206-PA 11..262 6..257 655 48.8 Plus
Dsec\GM26205-PA 270 GM26205-PA 12..261 3..252 550 46.2 Plus
Dsec\GM19880-PA 263 GM19880-PA 11..263 6..255 526 43.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18654-PA 263 GD18654-PA 1..257 1..255 1249 91.8 Plus
Dsim\GD18652-PA 265 GD18652-PA 14..264 6..257 786 58.7 Plus
Dsim\GD20751-PA 264 GD20751-PA 12..263 3..255 651 49 Plus
Dsim\GD20753-PA 262 GD20753-PA 11..262 6..257 645 48.4 Plus
Dsim\GD20752-PA 265 GD20752-PA 12..265 3..256 546 45.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11026-PA 263 GJ11026-PA 11..261 6..256 618 44.6 Plus
Dvir\GJ11028-PA 261 GJ11028-PA 9..261 4..256 569 44.3 Plus
Dvir\GJ22069-PA 248 GJ22069-PA 1..237 10..245 478 41.8 Plus
Dvir\GJ11027-PA 244 GJ11027-PA 9..231 4..247 474 41.4 Plus
Dvir\GJ22068-PA 217 GJ22068-PA 1..217 38..253 452 41 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20709-PA 266 GK20709-PA 14..246 26..257 528 45.1 Plus
Dwil\GK20708-PA 255 GK20708-PA 11..250 6..245 486 40.5 Plus
Dwil\GK20706-PA 215 GK20706-PA 1..208 38..245 431 43.8 Plus
Dwil\GK14510-PA 217 GK14510-PA 11..160 6..155 412 51.3 Plus
Dwil\GK20710-PA 205 GK20710-PA 11..203 6..198 409 41.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25995-PA 254 GE25995-PA 1..254 1..254 1144 82.7 Plus
Dyak\GE25994-PA 264 GE25994-PA 14..257 6..250 744 58.8 Plus
Dyak\GE24724-PA 262 GE24724-PA 11..262 6..257 673 50.4 Plus
Dyak\GE24722-PA 264 GE24722-PA 12..262 3..253 627 49 Plus
Dyak\GE24723-PA 264 GE24723-PA 12..258 3..249 539 47.2 Plus