Clone IP09958 Report

Search the DGRC for IP09958

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:58
Vector:pOT2
Associated Gene/TranscriptCpr49Ab-RA
Protein status:IP09958.pep: validated not full length
Preliminary Size:780
Sequenced Size:847

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cpr49Ab 2008-04-29 Release 5.5 accounting
Cpr49Ab 2008-08-15 Release 5.9 accounting
Cpr49Ab 2008-12-18 5.12 accounting

Clone Sequence Records

IP09958.complete Sequence

847 bp (847 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024335

> IP09958.complete
CTGCGCGTAGCGATCGTTCTAGTTATAGCCCTTGCGGCTGCCGTTCTGGC
CCAAAACGATGGACGGTATCGTCCTCCGCCGACAAGGGCGAGTGCCGGAG
ATGGTAGGTACCGCGGCGGTAACGATGGACGTTATCGCGGTGGAGGCGAT
GGACGATACTCGGGTGGCAACGATGGACGCTACGTGCACATGGACAACAA
GTACAAGCACGACGATCGTCCTGGTGGGGATTACTCCGGCGATGCAGGTC
GCTATGTGGGGGACAAGAACAGGGGTGGTGGAGGCGGTGGTGGCGGTGGT
GGTGGTGGTGGAGGTGGATCCGGGGCAGGTGGTGGTGGAGCAGCAGTTGT
AGTGCCCAGAACCTCAGCCAGGCCTCAACCAAGACCCACCACTGCAGCGC
CGCCGGCTATTGCCGATCCAACTGCCAATCTTCCCAAGGGACGTGGCACC
GGCGAAGGAGGCAACGGATGGGCCATCATCCGCCAGGAAGACGATGTGGA
GGTGGATGGCTATCACTATCTTTGGGAAACTGAGAACGGCATCTTAGGCG
AGGAAAGTGGACGCATCGAAAAGCTGACCGAGGAGGAGGGACTTCGTTCC
AAGGGATTCTACGAGTACACTGGACCCGACGGCATCCTCTACCGCGTGGA
CTATGTAGCAGACGACAATGGCTTTGTGCCAAGTGCCGCCCACCTGCCCA
CAGCGCCACCACCACCGCCCTATGTGGAAAAGTTACTCGCCTTTTTGGAA
GCAAATGCCAAGACGAAGAAATAAAGTTGGATTTTACAAGTGTATACATT
TTAAATTGAATAAATTGATGTGCCATAGGAAAAAAAAAAAAAAAAAA

IP09958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ab-RA 894 Cpr49Ab-RA 58..888 1..831 4155 100 Plus
Cpr49Ab.a 829 Cpr49Ab.a 331..829 331..829 2495 100 Plus
Cpr49Ab.a 829 Cpr49Ab.a 58..340 1..283 1415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8265791..8266305 12..526 2500 99 Plus
chr2R 21145070 chr2R 8266353..8266660 522..829 1495 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12378527..12379041 12..526 2560 99.8 Plus
2R 25286936 2R 12379089..12379398 522..831 1550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12379726..12380240 12..526 2560 99.8 Plus
2R 25260384 2R 12380288..12380597 522..831 1550 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:08:18 has no hits.

IP09958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:09:30 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8266353..8266660 522..829 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:44:20 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..780 1..774 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:35:34 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..780 1..774 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:24 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..780 1..774 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:10 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..780 1..774 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:59 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..780 1..774 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:02 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..780 1..774 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:35:33 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..835 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:24 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 24..852 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:11 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 7..780 1..774 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:59 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ab-RA 24..852 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:30 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12378527..12379036 12..521 100 -> Plus
2R 12379089..12379396 522..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:30 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12378527..12379036 12..521 100 -> Plus
2R 12379089..12379396 522..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:30 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12378527..12379036 12..521 100 -> Plus
2R 12379089..12379396 522..829 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:24 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8266032..8266541 12..521 100 -> Plus
arm_2R 8266594..8266901 522..829 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:20 Download gff for IP09958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12379726..12380235 12..521 100 -> Plus
2R 12380288..12380595 522..829 100   Plus

IP09958.pep Sequence

Translation from 0 to 773

> IP09958.pep
LRVAIVLVIALAAAVLAQNDGRYRPPPTRASAGDGRYRGGNDGRYRGGGD
GRYSGGNDGRYVHMDNKYKHDDRPGGDYSGDAGRYVGDKNRGGGGGGGGG
GGGGGGSGAGGGGAAVVVPRTSARPQPRPTTAAPPAIADPTANLPKGRGT
GEGGNGWAIIRQEDDVEVDGYHYLWETENGILGEESGRIEKLTEEEGLRS
KGFYEYTGPDGILYRVDYVADDNGFVPSAAHLPTAPPPPPYVEKLLAFLE
ANAKTKK*

IP09958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12853-PA 264 GF12853-PA 3..263 1..257 755 79.2 Plus
Dana\GF12855-PA 324 GF12855-PA 163..257 159..256 203 43.9 Plus
Dana\GF23521-PA 109 GF23521-PA 28..106 159..236 174 43 Plus
Dana\GF23525-PA 103 GF23525-PA 24..101 159..236 172 41 Plus
Dana\GF10925-PA 107 GF10925-PA 22..102 159..238 170 42 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20287-PA 260 GG20287-PA 3..260 1..257 883 94.6 Plus
Dere\GG22686-PA 135 GG22686-PA 23..123 138..237 188 41.2 Plus
Dere\GG14086-PA 102 GG14086-PA 23..102 158..236 176 40 Plus
Dere\GG15326-PA 109 GG15326-PA 28..106 159..236 175 43 Plus
Dere\GG15459-PA 122 GG15459-PA 27..113 160..252 174 43.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20693-PA 255 GH20693-PA 19..251 18..251 574 55.8 Plus
Dgri\GH20695-PA 325 GH20695-PA 162..254 159..254 210 45.8 Plus
Dgri\GH15846-PA 106 GH15846-PA 26..106 159..238 192 44.4 Plus
Dgri\GH15845-PA 106 GH15845-PA 26..106 159..238 192 44.4 Plus
Dgri\GH15646-PA 103 GH15646-PA 26..103 159..235 179 46.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ab-PA 259 CG30042-PA 3..259 1..257 1393 100 Plus
Cpr47Ef-PD 601 CG13214-PD 7..226 6..247 303 34.1 Plus
Cpr47Ef-PC 612 CG13214-PC 7..226 6..247 303 34.1 Plus
Cpr49Ac-PG 315 CG8502-PG 11..243 3..254 259 30.8 Plus
Cpr49Ac-PF 315 CG8502-PF 11..243 3..254 259 30.8 Plus
Cpr49Ac-PC 324 CG8502-PC 11..252 3..254 257 30.5 Plus
Cpr49Aa-PB 144 CG30045-PB 20..125 145..249 233 47.7 Plus
Cpr49Ae-PA 134 CG8505-PA 29..125 158..249 209 46.4 Plus
Cpr65Az-PA 239 CG12330-PA 60..211 110..251 206 36.1 Plus
Cpr47Ea-PA 135 CG9079-PA 23..123 138..237 202 41.2 Plus
Cpr49Ac-PE 285 CG8502-PE 27..213 57..254 195 31.6 Plus
Cpr49Ac-PA 294 CG8502-PA 38..222 59..254 188 31.4 Plus
Lcp65Ac-PA 109 CG6956-PA 28..106 159..236 182 43 Plus
Cpr65Ax2-PB 102 CG18777-PB 22..100 159..236 180 44.3 Plus
Cpr65Ax2-PA 102 CG18777-PA 22..100 159..236 180 44.3 Plus
Cpr65Ax1-PA 102 CG34270-PA 22..100 159..236 180 44.3 Plus
Cpr67Fb-PA 122 CG18348-PA 28..113 161..252 178 40.4 Plus
Lcp65Ag2-PA 105 CG10534-PA 25..103 159..236 174 41.8 Plus
Lcp65Ag1-PA 105 CG10530-PA 25..103 159..236 174 41.8 Plus
Lcp65Ag3-PA 105 CG18779-PA 25..103 159..236 174 41.8 Plus
Lcp65Af-PA 100 CG10533-PA 20..98 159..236 169 40.5 Plus
Cpr78Cc-PA 119 CG7658-PA 26..115 158..252 165 36.7 Plus
Cpr65Ec-PA 127 CG8634-PA 32..115 163..252 163 39.6 Plus
frm-PD 268 CG10625-PD 52..155 41..147 163 41.1 Plus
frm-PA 268 CG10625-PA 52..155 41..147 163 41.1 Plus
frm-PJ 752 CG10625-PJ 52..155 41..147 163 41.1 Plus
frm-PI 766 CG10625-PI 52..155 41..147 163 41.1 Plus
Lcp65Ad-PB 108 CG6955-PB 29..104 159..233 158 39.5 Plus
Lcp65Ad-PA 108 CG6955-PA 29..104 159..233 158 39.5 Plus
frm-PB 682 CG10625-PB 442..577 19..147 157 35.7 Plus
frm-PC 682 CG10625-PC 442..577 19..147 157 35.7 Plus
frm-PH 1180 CG10625-PH 442..577 19..147 157 35.7 Plus
CG5778-PC 117 CG5778-PC 15..105 9..113 156 41.9 Plus
CG5778-PA 117 CG5778-PA 15..105 9..113 156 41.9 Plus
Cpr49Af-PB 126 CG8510-PB 23..114 160..249 154 37 Plus
Cpr49Af-PA 126 CG8510-PA 23..114 160..249 154 37 Plus
Cpr67Fa2-PA 134 CG18349-PA 17..116 147..252 153 33.6 Plus
Cpr67Fa1-PA 134 CG7941-PA 17..116 147..252 153 33.6 Plus
Cpr65Av-PA 111 CG32405-PA 39..109 164..233 149 36.6 Plus
CG5172-PD 172 CG5172-PD 94..171 33..112 148 44.6 Plus
Cpr11B-PB 195 CG2555-PB 14..153 111..239 147 30 Plus
Cpr11B-PA 197 CG2555-PA 14..153 111..239 147 30 Plus
CG5172-PD 172 CG5172-PD 26..101 39..113 146 44.9 Plus
Cpr65Aw-PA 117 CG32404-PA 34..104 164..233 145 39.4 Plus
CG13376-PD 204 CG13376-PD 6..116 3..114 145 36.1 Plus
Lcp65Ae-PA 99 CG10529-PA 21..98 159..235 144 37.2 Plus
Lcp1-PB 130 CG11650-PB 14..120 136..252 143 33.3 Plus
Lcp1-PA 130 CG11650-PA 14..120 136..252 143 33.3 Plus
Lcp65Aa-PA 102 CG7287-PA 25..100 159..233 140 36.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19054-PA 279 GI19054-PA 2..276 1..252 608 53.8 Plus
Dmoj\GI19056-PA 325 GI19056-PA 163..258 156..254 204 44.4 Plus
Dmoj\GI12627-PA 112 GI12627-PA 32..110 159..236 174 41.8 Plus
Dmoj\GI19058-PA 136 GI19058-PA 24..126 152..249 171 47.6 Plus
Dmoj\GI12628-PA 104 GI12628-PA 27..104 159..235 169 41 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11630-PA 271 GL11630-PA 45..271 34..257 639 74.4 Plus
Dper\GL11632-PA 371 GL11632-PA 195..287 159..254 207 43.8 Plus
Dper\GL11629-PA 149 GL11629-PA 21..129 143..249 188 45.9 Plus
Dper\GL15520-PA 104 GL15520-PA 24..102 159..236 181 44.3 Plus
Dper\GL15517-PA 104 GL15517-PA 24..102 159..236 181 44.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15599-PA 264 GA15599-PA 3..264 1..257 755 73.3 Plus
Dpse\GA15602-PA 149 GA15602-PA 21..129 143..249 186 46.8 Plus
Dpse\GA23851-PA 104 GA23851-PA 24..102 159..236 181 44.3 Plus
Dpse\GA23852-PA 104 GA23852-PA 24..102 159..236 177 43 Plus
Dpse\GA15076-PA 104 GA15076-PA 24..102 159..236 167 44.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21374-PA 259 GM21374-PA 3..259 1..257 1255 98.1 Plus
Dsec\GM14760-PA 109 GM14760-PA 28..106 159..236 181 43 Plus
Dsec\GM19678-PA 109 GM19678-PA 28..106 159..236 181 43 Plus
Dsec\GM21373-PA 294 GM21373-PA 183..275 159..249 177 50.5 Plus
Dsec\GM13862-PA 101 GM13862-PA 23..100 159..235 174 42.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10871-PA 220 GD10871-PA 3..220 1..257 868 83.3 Plus
Dsim\GD10870-PA 267 GD10870-PA 156..248 159..249 179 50.5 Plus
Dsim\GD13939-PA 107 GD13939-PA 26..104 159..236 175 43 Plus
Dsim\GD13145-PA 98 GD13145-PA 20..96 159..234 174 42.9 Plus
Dsim\GD13153-PA 105 GD13153-PA 25..103 159..236 166 40.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20023-PA 273 GJ20023-PA 3..268 1..250 570 55.7 Plus
Dvir\GJ20025-PA 329 GJ20025-PA 7..257 3..254 208 29.6 Plus
Dvir\GJ12749-PA 105 GJ12749-PA 24..103 158..236 188 46.2 Plus
Dvir\GJ12680-PA 105 GJ12680-PA 25..103 159..236 181 44.3 Plus
Dvir\GJ12681-PA 105 GJ12681-PA 25..103 159..236 181 44.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22927-PA 251 GK22927-PA 4..251 3..257 694 72 Plus
Dwil\GK22929-PA 331 GK22929-PA 163..255 159..254 195 43.8 Plus
Dwil\GK20648-PA 137 GK20648-PA 24..124 138..237 181 38.2 Plus
Dwil\GK16922-PA 108 GK16922-PA 29..106 160..236 180 46.2 Plus
Dwil\GK17269-PA 108 GK17269-PA 23..105 155..236 171 42.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12448-PA 258 GE12448-PA 3..258 1..257 886 94.6 Plus
Dyak\GE12447-PA 210 GE12447-PA 53..158 145..249 181 47.7 Plus
Dyak\GE12450-PA 300 GE12450-PA 139..229 159..255 169 41.2 Plus
Dyak\GE21770-PA 122 GE21770-PA 27..113 160..252 162 41.1 Plus
Dyak\GE13041-PA 135 GE13041-PA 23..118 138..232 155 38.1 Plus

IP09958.hyp Sequence

Translation from 12 to 773

> IP09958.hyp
IVLVIALAAAVLAQNDGRYRPPPTRASAGDGRYRGGNDGRYRGGGDGRYS
GGNDGRYVHMDNKYKHDDRPGGDYSGDAGRYVGDKNRGGGGGGGGGGGGG
GGSGAGGGGAAVVVPRTSARPQPRPTTAAPPAIADPTANLPKGRGTGEGG
NGWAIIRQEDDVEVDGYHYLWETENGILGEESGRIEKLTEEEGLRSKGFY
EYTGPDGILYRVDYVADDNGFVPSAAHLPTAPPPPPYVEKLLAFLEANAK
TKK*

IP09958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ab-PA 259 CG30042-PA 7..259 1..253 1376 100 Plus
Cpr47Ef-PD 601 CG13214-PD 7..226 2..243 303 34.1 Plus
Cpr47Ef-PC 612 CG13214-PC 7..226 2..243 303 34.1 Plus
Cpr49Ac-PG 315 CG8502-PG 13..243 1..250 258 31 Plus
Cpr49Ac-PF 315 CG8502-PF 13..243 1..250 258 31 Plus