Clone IP09963 Report

Search the DGRC for IP09963

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:63
Vector:pOT2
Associated Gene/TranscriptCG30338-RA
Protein status:IP09963.pep: gold
Preliminary Size:867
Sequenced Size:1023

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30338 2008-04-29 Release 5.5 accounting
CG30338 2008-08-15 Release 5.9 accounting
CG1902 2008-08-15 Release 5.9 accounting
CG30338 2008-12-18 5.12 accounting
CG1902 2008-12-18 5.12 accounting

Clone Sequence Records

IP09963.complete Sequence

1023 bp (1023 high quality bases) assembled on 2005-06-20

GenBank Submission: BT023523

> IP09963.complete
ATCACAAACCTCTGCTCTGCCGAAACTGCCCGACCGTAAAAAGTGCATTT
AACCAAACCCAATCAGCGACCAATTGACAAGCCATGGCCGATGAGGAGCT
GCAAACCTACCGTCGCTGCGTTGGCCTGCAGCTGGAGGAGCTGGAGCTGC
TGAGCTCCATATACTGCGCGCCCGGAGAGCTGCATATGCTCGATGCCGGC
GTAGTGGCTGATTTCAATGAGTTTCTCAAGGATGATAAGACAAAACCCGC
TACTAGCCTTCTATCCCATTTGGAGTATGTGGTCAAATTGACTCTACCAG
GCAAACAGTGCGTGGAAGTGCGAGTGGAACTGCCGCACCTATATCCGCTT
TTGGAGCAGGCACGCGTCAGTGTACACACTACGCTACTGGGAAAATCCAA
GGAGCAGCGCTTAAAGAATGATTTGGAGCAGTATCATGGTGAAAGGCGGG
AGGAGGACGCCGAGCCGTACATCTTCCAGCTGCTGAGCTGGCTGCAGGAC
CGCATCGAGGATCTGTTAAAACGACCAGCTTCCGAGTTTGAAGTGCAGCA
GGTAGCATCATCAGACCCGCAACAGCCACCAGCTACGGAACTTCAGAGAA
TTTGGATTTATTCGCATCACATCAAATCCAGTGCCAAGCGGCAGGAGCTG
ATTCGGCAGGCCCGACAGTTGGAGCTCACAGGATTCAGTAGACCCGGTAA
ACCGGGCATCATATGCGTGGAAGGTGATTCGGCAAATGTACAGGAATTCT
GGCGCACCATCAAGGCCCTGCGCTGGCAGAAGATCAGCGTGGTGCGGACG
GAGCCTCGGCAGCGCAAGCGGGGATTCGAGGACTTCAGCGAACAGCTTTT
TAATGCCGAAGAAGGCGTCATGAACATGGGCCAGTTCATTCGATTCCTCG
AAGCCCACGGATTTGGCTACATGAAGTCGGAATTGTTTGGTTTAGCCTGA
GCACTGGATTTCCCATCAAAATTTAACATGTTAATAAAGTTTGTTATATC
ATTTCAAAAAAAAAAAAAAAAAA

IP09963.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG30338-RA 1037 CG30338-RA 33..1037 1..1005 5025 100 Plus
CG1902-RA 1804 CG1902-RA 1..77 5..81 385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5486075..5487000 80..1005 4600 99.8 Plus
chr2R 21145070 chr2R 5481574..5481654 1..81 405 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9598580..9599508 80..1008 4645 100 Plus
2R 25286936 2R 9594079..9594159 1..81 405 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9599779..9600707 80..1008 4645 100 Plus
2R 25260384 2R 9595278..9595358 1..81 405 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:59:29 has no hits.

IP09963.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:00:42 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5481574..5481654 1..81 100 -> Plus
chr2R 5486077..5487000 82..1005 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:44:24 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 1..867 84..950 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:46 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 1..867 84..950 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:11 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 1..867 84..950 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:35 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 1..867 84..950 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:53:42 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 1..867 84..950 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:26 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 1..1005 1..1005 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:46 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 33..1037 1..1005 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:11 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 35..1039 1..1005 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:36 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 1..1005 1..1005 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:53:42 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
CG30338-RA 35..1039 1..1005 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:00:42 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9594079..9594159 1..81 100 -> Plus
2R 9598582..9599505 82..1005 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:00:42 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9594079..9594159 1..81 100 -> Plus
2R 9598582..9599505 82..1005 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:00:42 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9594079..9594159 1..81 100 -> Plus
2R 9598582..9599505 82..1005 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:11 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5481584..5481664 1..81 100 -> Plus
arm_2R 5486087..5487010 82..1005 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:12 Download gff for IP09963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9599781..9600704 82..1005 100   Plus
2R 9595278..9595358 1..81 100 -> Plus

IP09963.pep Sequence

Translation from 83 to 949

> IP09963.pep
MADEELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKD
DKTKPATSLLSHLEYVVKLTLPGKQCVEVRVELPHLYPLLEQARVSVHTT
LLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRIEDLLKRPAS
EFEVQQVASSDPQQPPATELQRIWIYSHHIKSSAKRQELIRQARQLELTG
FSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRKRGFED
FSEQLFNAEEGVMNMGQFIRFLEAHGFGYMKSELFGLA*

IP09963.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12482-PA 288 GF12482-PA 1..288 1..288 1137 76.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24092-PA 288 GG24092-PA 1..288 1..288 1401 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22934-PA 280 GH22934-PA 2..280 5..288 875 62.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG30338-PA 288 CG30338-PA 1..288 1..288 1492 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18420-PA 283 GI18420-PA 2..283 5..288 1010 68.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17149-PA 285 GL17149-PA 1..285 1..288 1097 75.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15769-PA 288 GA15769-PA 1..288 1..288 1071 74.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21140-PA 288 GM21140-PA 1..288 1..288 1496 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10669-PA 288 GD10669-PA 1..288 1..288 1501 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21506-PA 279 GJ21506-PA 2..279 5..288 1011 69 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15950-PA 289 GK15950-PA 1..289 1..288 983 62.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19292-PA 288 GE19292-PA 1..288 1..288 1374 92.4 Plus

IP09963.hyp Sequence

Translation from 83 to 949

> IP09963.hyp
MADEELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKD
DKTKPATSLLSHLEYVVKLTLPGKQCVEVRVELPHLYPLLEQARVSVHTT
LLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRIEDLLKRPAS
EFEVQQVASSDPQQPPATELQRIWIYSHHIKSSAKRQELIRQARQLELTG
FSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRKRGFED
FSEQLFNAEEGVMNMGQFIRFLEAHGFGYMKSELFGLA*

IP09963.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG30338-PA 288 CG30338-PA 1..288 1..288 1492 100 Plus