Clone IP09974 Report

Search the DGRC for IP09974

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:74
Vector:pOT2
Associated Gene/TranscriptCG31267-RA
Protein status:IP09974.pep:
Preliminary Size:828
Sequenced Size:921

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31267 2008-04-29 Release 5.5 accounting
CG31267 2008-08-15 Release 5.9 accounting
CG31267 2008-12-18 5.12 accounting

Clone Sequence Records

IP09974.complete Sequence

921 bp (921 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023519

> IP09974.complete
TCTTACCAAACCGGAGCGGTTTCTACACTCGTCCTCGTCCTGTTGGCGTT
ATCCTTTTCGGAGGCAAGTTTACGCCGTCGGGCCTTCACTTCAGAAAAAT
CCGAAACCGCGAATAAATTTAGCTCCCGAATCGTCGGAGGAGAAGAATCC
GATGTCCTGGCGGCACCCTATCTAGTCTCGCTCCAAAACGCCTATGGTAA
CCACTTTTGTGCCGGCTCCATTATCCACGATCAGTGGGTCATCACCGCGG
CTAGTTGCCTGGCTGGATTGCGAAAGAACAACGTGCAGGTGGTGACCACC
ACCTATAATCACTGGGGATCGGAGGGCTGGATATACTCCGTGGAGGATAT
CGTCATGCACTGCAACTTCGACAGCCCCATGTACCATAATGACATTGCCC
TGATCAAGACGCATGCACTATTCGATTACGATGATGTCACTCAGAATATC
ACAATCGCTCCGTTGGAGGATTTGACCGATGGTGAAACGCTAACCATGTA
CGGATACGGCAGCACGGAGATCGGAGGAGATTTCTCATGGCAGCTGCAGC
AGTTGGATGTAACCTATGTCGCGCCGGAAAAGTGCAATGCCACGTACGGC
GGTACTCCAGATCTGGATGTGGGTCACCTTTGTGCCGTGGGAAAGGTGGG
AGCCGGAGCATGTCATGGAGATACCGGAGGACCCATCGTTGACAGTCGTG
GTCGCTTGGTGGGCGTTGGTAACTGGGGCGTTCCGTGCGGCTATGGATTT
CCCGATGTTTTTGCCCGCATTAGCTTTTACTACAGCTGGATTATATCAAC
GATTAACGGATGTGCTATTTCCTAAGTGCAAAAATTCGTATCAATTACTT
TTATCCTGGAAAAATAACTTTATTCAATAAAATACTGTAAAAATTAAAAA
AAAAAAAAAAAAAAAAAAAAA

IP09974.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31267-RA 1160 CG31267-RA 28..922 1..895 4475 100 Plus
CG31267.a 1159 CG31267.a 27..921 1..895 4475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12959009..12959707 197..895 3495 100 Plus
chr3R 27901430 chr3R 12958647..12958843 1..197 985 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17134585..17135283 197..895 3495 100 Plus
3R 32079331 3R 17134223..17134419 1..197 985 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16875416..16876114 197..895 3495 100 Plus
3R 31820162 3R 16875054..16875250 1..197 985 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:02:55 has no hits.

IP09974.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:04:10 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12958647..12958843 1..197 100 -> Plus
chr3R 12959010..12959707 198..895 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:44:31 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 4..828 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:59:43 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 4..828 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:40 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 4..828 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:17 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 4..828 1..825 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:56:24 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 4..828 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:41:51 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 27..921 1..895 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:59:43 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 27..921 1..895 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:40 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 27..921 1..895 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:18 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 29..923 1..895 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:56:24 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
CG31267-RA 27..921 1..895 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:10 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17134223..17134419 1..197 100 -> Plus
3R 17134586..17135283 198..895 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:10 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17134223..17134419 1..197 100 -> Plus
3R 17134586..17135283 198..895 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:10 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17134223..17134419 1..197 100 -> Plus
3R 17134586..17135283 198..895 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:40 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12959945..12960141 1..197 100 -> Plus
arm_3R 12960308..12961005 198..895 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:12 Download gff for IP09974.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16875417..16876114 198..895 100   Plus
3R 16875054..16875250 1..197 100 -> Plus

IP09974.pep Sequence

Translation from 0 to 824

> IP09974.pep
SYQTGAVSTLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEES
DVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTT
TYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNI
TIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYG
GTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGF
PDVFARISFYYSWIISTINGCAIS*

IP09974.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17131-PA 275 GF17131-PA 2..274 1..273 1036 70 Plus
Dana\GF17130-PA 240 GF17130-PA 2..240 36..274 643 50.2 Plus
Dana\GF19903-PA 267 GF19903-PA 35..261 41..270 479 42.2 Plus
Dana\GF17129-PA 274 GF17129-PA 7..261 10..270 468 39.1 Plus
Dana\GF17132-PA 272 GF17132-PA 37..261 39..264 467 41.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22050-PA 275 GG22050-PA 2..275 1..274 1335 88.7 Plus
Dere\GG22039-PA 258 GG22039-PA 25..258 41..274 618 47.4 Plus
Dere\GG22028-PA 266 GG22028-PA 34..260 41..270 494 43.9 Plus
Dere\GG22061-PA 272 GG22061-PA 9..261 11..264 464 39.2 Plus
Dere\GG22017-PA 273 GG22017-PA 36..261 42..270 446 42.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14064-PA 269 GH14064-PA 16..269 18..274 839 59.9 Plus
Dgri\GH14063-PA 285 GH14063-PA 31..285 24..274 595 43.5 Plus
Dgri\GH14066-PA 271 GH14066-PA 3..260 10..264 483 39.6 Plus
Dgri\GH14062-PA 266 GH14062-PA 1..262 7..272 476 38 Plus
Dgri\GH14252-PA 282 GH14252-PA 7..266 10..268 470 38.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG31267-PA 275 CG31267-PA 2..275 1..274 1468 100 Plus
CG31266-PB 282 CG31266-PB 11..282 10..274 640 44.1 Plus
CG5246-PA 272 CG5246-PA 37..261 39..264 496 42.5 Plus
CG31265-PA 266 CG31265-PA 34..260 41..270 494 43 Plus
CG31269-PB 273 CG31269-PB 3..261 8..270 463 39.2 Plus
CG17475-PB 288 CG17475-PB 5..273 5..270 461 37.4 Plus
CG17475-PA 288 CG17475-PA 5..273 5..270 461 37.4 Plus
CG5255-PA 273 CG5255-PA 28..249 42..264 451 41.1 Plus
CG17477-PA 267 CG17477-PA 27..253 44..270 429 37.6 Plus
CG4053-PB 265 CG4053-PB 33..260 42..271 416 36.4 Plus
epsilonTry-PA 256 CG18681-PA 26..252 39..267 312 36.5 Plus
zetaTry-PA 280 CG12387-PA 3..279 8..270 308 32.6 Plus
gammaTry-PA 253 CG30028-PA 26..251 39..266 302 32.9 Plus
deltaTry-PA 253 CG12351-PA 26..251 39..266 302 32.9 Plus
CG30031-PA 253 CG30031-PA 26..251 39..266 302 32.9 Plus
CG30025-PA 253 CG30025-PA 26..251 39..266 299 32.5 Plus
alphaTry-PA 256 CG18444-PA 26..254 39..269 299 32.5 Plus
kappaTry-PC 263 CG12388-PC 5..262 12..273 298 33.1 Plus
CG31954-PA 277 CG31954-PA 46..271 39..264 298 31.9 Plus
CG16749-PA 265 CG16749-PA 29..257 43..264 285 32.1 Plus
CG12951-PA 265 CG12951-PA 28..259 42..266 278 30.3 Plus
Try29F-PD 267 CG9564-PD 37..266 39..270 277 32.1 Plus
Try29F-PC 267 CG9564-PC 37..266 39..270 277 32.1 Plus
CG4386-PA 372 CG4386-PA 126..354 43..264 277 31.2 Plus
CG17571-PB 258 CG17571-PB 30..254 43..267 273 33.2 Plus
CG17571-PA 258 CG17571-PA 30..254 43..267 273 33.2 Plus
CG11836-PI 281 CG11836-PI 44..281 43..274 273 29.6 Plus
CG11836-PJ 333 CG11836-PJ 96..333 43..274 273 29.6 Plus
CG7829-PA 253 CG7829-PA 27..250 43..269 272 32.5 Plus
betaTry-PB 253 CG18211-PB 26..251 39..266 267 29.4 Plus
betaTry-PA 253 CG18211-PA 26..251 39..266 267 29.4 Plus
Jon65Aiv-PA 271 CG6467-PA 7..265 10..264 264 29.9 Plus
lambdaTry-PA 272 CG12350-PA 1..260 7..268 260 29.5 Plus
CG11192-PB 279 CG11192-PB 12..259 28..264 260 29.4 Plus
CG32269-PB 332 CG32269-PB 91..324 26..263 259 30.4 Plus
CG32269-PA 332 CG32269-PA 91..324 26..263 259 30.4 Plus
Send1-PA 255 CG17012-PA 27..244 41..269 257 32.9 Plus
Ser8-PA 260 CG4812-PA 29..254 38..265 257 31.7 Plus
Jon99Cii-PA 265 CG31034-PA 3..257 11..264 257 30.8 Plus
Jon99Ciii-PB 265 CG31362-PB 3..257 11..264 257 30.8 Plus
Jon99Ciii-PA 265 CG31362-PA 3..257 11..264 257 30.8 Plus
CG11836-PF 223 CG11836-PF 8..223 66..274 256 29.5 Plus
CG11836-PE 223 CG11836-PE 8..223 66..274 256 29.5 Plus
CG11836-PG 223 CG11836-PG 8..223 66..274 256 29.5 Plus
CG11836-PC 223 CG11836-PC 8..223 66..274 256 29.5 Plus
CG11836-PA 223 CG11836-PA 8..223 66..274 256 29.5 Plus
CG11836-PB 223 CG11836-PB 8..223 66..274 256 29.5 Plus
etaTry-PA 262 CG12386-PA 27..254 43..264 256 32.5 Plus
CG8299-PA 260 CG8299-PA 25..252 41..264 255 34.1 Plus
CG13430-PB 267 CG13430-PB 18..263 30..268 252 29.6 Plus
CG13430-PA 267 CG13430-PA 18..263 30..268 252 29.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24440-PA 271 GI24440-PA 24..269 25..274 877 64.4 Plus
Dmoj\GI24439-PA 287 GI24439-PA 13..282 11..271 559 39.3 Plus
Dmoj\GI24441-PA 272 GI24441-PA 4..264 10..267 480 38.4 Plus
Dmoj\GI24438-PA 269 GI24438-PA 6..265 10..272 477 37.3 Plus
Dmoj\GI24442-PA 279 GI24442-PA 30..256 42..269 444 38.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27274-PA 278 GL27274-PA 22..278 19..274 1094 76.7 Plus
Dper\GL27273-PA 291 GL27273-PA 60..291 43..274 634 49.1 Plus
Dper\GL27272-PA 264 GL27272-PA 8..258 12..270 500 39 Plus
Dper\GL27275-PA 273 GL27275-PA 8..262 8..264 467 39.5 Plus
Dper\GL27214-PA 286 GL27214-PA 6..271 6..270 467 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16136-PA 278 GA16136-PA 22..278 19..274 1090 76.7 Plus
Dpse\GA16135-PA 291 GA16135-PA 60..291 43..274 633 49.1 Plus
Dpse\GA18759-PA 273 GA18759-PA 8..262 8..264 466 39.5 Plus
Dpse\GA18766-PA 280 GA18766-PA 29..256 41..269 466 40 Plus
Dpse\GA14522-PA 286 GA14522-PA 6..271 6..270 466 39.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15212-PA 275 GM15212-PA 2..275 1..274 1364 92 Plus
Dsec\GM15211-PA 282 GM15211-PA 51..282 43..274 622 47.8 Plus
Dsec\GM15213-PA 272 GM15213-PA 9..261 11..264 473 39.6 Plus
Dsec\GM15210-PA 266 GM15210-PA 34..260 41..270 463 41.7 Plus
Dsec\GM15383-PA 289 GM15383-PA 7..274 7..270 449 38.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19143-PA 275 GD19143-PA 2..275 1..274 1369 92.7 Plus
Dsim\GD19144-PA 272 GD19144-PA 9..261 11..264 476 40 Plus
Dsim\GD19141-PA 266 GD19141-PA 34..260 41..270 471 42.6 Plus
Dsim\GD20249-PA 288 GD20249-PA 6..273 7..270 451 38.6 Plus
Dsim\GD19145-PA 273 GD19145-PA 27..249 41..264 447 40.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10715-PA 274 GJ10715-PA 2..273 1..274 867 61.7 Plus
Dvir\GJ10714-PA 291 GJ10714-PA 33..291 23..274 593 42.1 Plus
Dvir\GJ10717-PA 272 GJ10717-PA 26..261 27..264 476 40.8 Plus
Dvir\GJ10718-PA 280 GJ10718-PA 15..257 27..269 451 37.6 Plus
Dvir\GJ10713-PA 268 GJ10713-PA 36..264 41..272 448 40.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12198-PA 274 GK12198-PA 2..274 1..274 959 67.3 Plus
Dwil\GK12197-PA 288 GK12197-PA 36..285 22..271 644 47.2 Plus
Dwil\GK12200-PA 276 GK12200-PA 4..265 12..264 475 38.9 Plus
Dwil\GK12196-PA 282 GK12196-PA 31..257 41..270 474 41.7 Plus
Dwil\GK12195-PA 272 GK12195-PA 24..260 33..270 464 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10111-PA 275 GE10111-PA 2..275 1..274 1287 85.8 Plus
Dyak\GE24615-PA 282 GE24615-PA 51..282 43..274 625 47.8 Plus
Dyak\GE24614-PA 266 GE24614-PA 34..260 41..270 472 42.2 Plus
Dyak\GE10112-PA 272 GE10112-PA 7..261 7..264 472 39.4 Plus
Dyak\GE26105-PA 296 GE26105-PA 3..273 3..270 455 37.8 Plus

IP09974.hyp Sequence

Translation from 0 to 824

> IP09974.hyp
SYQTGAVSTLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEES
DVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTT
TYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNI
TIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYG
GTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGF
PDVFARISFYYSWIISTINGCAIS*

IP09974.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31267-PA 275 CG31267-PA 2..275 1..274 1468 100 Plus
CG31266-PB 282 CG31266-PB 11..282 10..274 640 44.1 Plus
CG5246-PA 272 CG5246-PA 37..261 39..264 496 42.5 Plus
CG31265-PA 266 CG31265-PA 34..260 41..270 494 43 Plus
CG31269-PB 273 CG31269-PB 3..261 8..270 463 39.2 Plus