Clone IP09987 Report

Search the DGRC for IP09987

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:99
Well:87
Vector:pOT2
Associated Gene/TranscriptProsbeta5R2-RA
Protein status:IP09987.pep: gold
Preliminary Size:840
Sequenced Size:1098

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31742 2008-04-29 Release 5.5 accounting
CG31742 2008-08-15 Release 5.9 accounting
CG31742 2008-12-18 5.12 accounting

Clone Sequence Records

IP09987.complete Sequence

1098 bp (1098 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023520

> IP09987.complete
ATCAGTCAGATATAAAAGATTTCAACATACTTAAAGTATAACCAACAACA
TTTAAACTTCAAATATAACCATTTGTACAACATGGCCCTGGAAAGTATTT
GTGGTATGGATAAGCTGCCATTTATGAAGAGCTTTGGATATCGCACCTCG
AAGCAGACAATTGAAGAAATCAGAGTCGCATCGAGTAACATGGATAATCC
CCTCGCCATAATGGCTCCGCCATATGAAAATCCACGGGAAAGTGTGAAAA
AACTGAATGCGCTAAGTGAAGTGCAGATAGATTTTGACCACGGAACCACC
ACGGTGGGTTTTGTTTACCAAGGTGGCATCATTTTGTGTGTGGATTCCAG
AGCCACGTCGGGAAAGTTAATTGGATCTCAGAGCATACATAAGGTCGTAC
AGGTCAACCAGTACATAATGGGTACCACTGCAGGTGGTGCAGCGGATTGC
ACATACTGGGATCGAGCTTTGACCAGGGAGTGCCGACTGCACGAGCTCCG
CTATAAGGAGCGACTTCCAGTCCAATCTGCTGCCAAATATATCTCCAACG
TGGCTGCGGAATACAAGGGAATGGGTCTCTGCATGGGAATGATGCTGGCC
GGTTGGTCGCCCGAAGGACCCAGTTTGGTATACGTGGACTCCAACGGCCT
GCGGATCCATGGAAAGCTTTTCGCCGTGGGCAGTGGAGCCCCCAATGCCC
TGGGAATTTTGGACTCTGACTACCGGTTGGATCTCAGTGATAACGAGGCC
TACGACCTGGCCTTCCTTGCAGTATATCATGCTACCATGACAGATATCTT
TTCAGGCGGTGTGGTGAGACTATATCACATGGATCAAGGAAACTGGAGGA
ATGTGGCCAATAAAGACTGCCAGGAACTGCATGAACAGTACTCAGGTGTG
GGAAATCAACAAACTCCCTAAGTTCTGCACTTCATTTGGTTAGAGCGTTA
AAGGTTTGTACTACGTTATCCATTTTCCGAATGAGTGAGTGACGGGAAAC
GAAAACACCACTTTTAGAACAAACATCTGCGTTTTACCAAATTAAGACCA
TCAAATAAATGCTGTTGACTTATTTATTTTCTAAAAAAAAAAAAAAAA

IP09987.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG31742-RA 1084 CG31742-RA 1..1084 1..1084 5420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17989048..17990125 4..1082 5210 99.1 Plus
chr2R 21145070 chr2R 6708155..6708200 559..604 185 93.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17990418..17991501 1..1084 5420 100 Plus
2R 25286936 2R 10820618..10820663 559..604 185 93.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17990418..17991501 1..1084 5420 100 Plus
Blast to na_te.dros performed 2019-03-15 22:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 6154..6223 9..82 117 66.2 Plus
Tirant 8526 Tirant TIRANT 8526bp 1310..1380 378..310 115 68.1 Minus

IP09987.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:22:41 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17989045..17990125 1..1082 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:44:34 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
CG31742-RA 1..840 82..921 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:59:45 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
CG31742-RA 1..840 82..921 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:15:59 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R2-RA 1..840 82..921 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:40:19 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
CG31742-RA 1..840 82..921 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:18:55 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R2-RA 1..840 82..921 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:41:54 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
CG31742-RA 1..1082 1..1082 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:59:44 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
CG31742-RA 1..1082 1..1082 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:15:59 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R2-RA 1..1082 1..1082 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:40:19 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
CG31742-RA 1..840 82..921 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:18:55 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R2-RA 1..1082 1..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:22:41 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17990418..17991499 1..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:22:41 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17990418..17991499 1..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:22:41 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17990418..17991499 1..1082 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:15:59 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17990418..17991499 1..1082 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:19:13 Download gff for IP09987.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17990418..17991499 1..1082 100   Plus

IP09987.pep Sequence

Translation from 81 to 920

> IP09987.pep
MALESICGMDKLPFMKSFGYRTSKQTIEEIRVASSNMDNPLAIMAPPYEN
PRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQ
SIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSA
AKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAVG
SGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHM
DQGNWRNVANKDCQELHEQYSGVGNQQTP*

IP09987.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13303-PA 314 GF13303-PA 1..270 1..270 913 58.5 Plus
Dana\GF14807-PA 308 GF14807-PA 1..276 1..279 882 56.3 Plus
Dana\GF13778-PA 284 GF13778-PA 1..272 1..270 786 52 Plus
Dana\GF21399-PA 293 GF21399-PA 1..272 1..272 543 41.2 Plus
Dana\GF20928-PA 1093 GF20928-PA 49..220 71..242 187 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21097-PA 245 GG21097-PA 1..235 37..271 1118 85.5 Plus
Dere\GG20051-PA 390 GG20051-PA 1..282 1..279 935 58.5 Plus
Dere\GG20151-PA 282 GG20151-PA 1..269 1..267 782 52.8 Plus
Dere\GG11178-PA 322 GG11178-PA 49..225 71..247 205 31.5 Plus
Dere\GG15711-PA 272 GG15711-PA 43..227 75..260 175 26.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23050-PA 315 GH23050-PA 1..270 1..270 904 58.1 Plus
Dgri\GH20460-PA 280 GH20460-PA 1..269 1..267 790 53.7 Plus
Dgri\GH14538-PA 275 GH14538-PA 1..261 1..275 491 40.6 Plus
Dgri\GH16666-PA 272 GH16666-PA 43..214 75..247 172 26.6 Plus
Dgri\GH19825-PA 222 GH19825-PA 15..196 71..252 169 28.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5R2-PB 279 CG31742-PB 1..279 1..279 1467 100 Plus
Prosbeta5R2-PA 279 CG31742-PA 1..279 1..279 1467 100 Plus
Prosbeta5R1-PA 315 CG9868-PA 1..274 1..274 924 58.8 Plus
Prosbeta5-PA 282 CG12323-PA 1..279 1..277 775 51.8 Plus
Prosbeta5-PB 282 CG12323-PB 1..279 1..277 775 51.8 Plus
Prosbeta2R2-PA 322 CG12161-PA 31..225 52..247 201 31 Plus
Prosbeta2-PA 272 CG3329-PA 16..227 48..260 188 24.9 Plus
Prosbeta2R1-PA 307 CG18341-PA 48..223 71..247 185 27.7 Plus
Prosalpha5-PB 244 CG10938-PB 34..200 71..227 175 28 Plus
Prosalpha5-PA 244 CG10938-PA 34..200 71..227 175 28 Plus
Prosbeta1-PA 224 CG8392-PA 1..191 64..247 166 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21121-PA 314 GI21121-PA 1..270 1..270 908 58.5 Plus
Dmoj\GI18886-PA 279 GI18886-PA 1..272 1..270 800 52.7 Plus
Dmoj\GI10892-PA 322 GI10892-PA 1..280 1..278 745 50.5 Plus
Dmoj\GI12054-PA 322 GI12054-PA 42..218 71..247 198 28.2 Plus
Dmoj\GI11352-PA 270 GI11352-PA 39..214 71..247 191 28.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11283-PA 305 GL11283-PA 1..254 1..270 843 55.6 Plus
Dper\GL14524-PA 270 GL14524-PA 1..263 1..271 689 50.2 Plus
Dper\GL11421-PA 244 GL11421-PA 34..201 71..228 189 30 Plus
Dper\GL21838-PA 312 GL21838-PA 49..224 71..247 169 27.1 Plus
Dper\GL15166-PA 327 GL15166-PA 25..223 48..247 168 25.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22086-PA 321 GA22086-PA 1..270 1..270 920 58.9 Plus
Dpse\GA11556-PA 279 GA11556-PA 1..272 1..270 809 54.6 Plus
Dpse\GA25177-PA 270 GA25177-PA 1..263 1..271 689 50.5 Plus
Dpse\GA10654-PA 244 GA10654-PA 34..201 71..228 189 30 Plus
Dpse\GA26418-PA 312 GA26418-PA 49..224 71..247 174 27.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17255-PA 279 GM17255-PA 1..277 1..277 1378 89.9 Plus
Dsec\GM15565-PA 315 GM15565-PA 1..274 1..274 932 58.8 Plus
Dsec\GM21240-PA 282 GM21240-PA 1..280 1..278 793 51.6 Plus
Dsec\GM10658-PA 322 GM10658-PA 38..225 59..247 188 31.6 Plus
Dsec\GM12440-PA 307 GM12440-PA 25..223 48..247 182 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24120-PA 279 GD24120-PA 1..277 1..277 1381 89.9 Plus
Dsim\GD10758-PA 282 GD10758-PA 1..280 1..278 793 51.6 Plus
Dsim\GD19639-PA 322 GD19639-PA 36..225 57..247 189 31.8 Plus
Dsim\GD16756-PA 307 GD16756-PA 48..223 71..247 180 27.1 Plus
Dsim\GD25066-PA 114 GD25066-PA 21..73 222..274 176 56.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20967-PA 312 GJ20967-PA 1..270 1..270 905 57.4 Plus
Dvir\GJ21921-PA 279 GJ21921-PA 1..272 1..270 808 54.6 Plus
Dvir\GJ16567-PA 328 GJ16567-PA 1..271 1..271 778 51.7 Plus
Dvir\GJ11606-PA 270 GJ11606-PA 41..212 75..247 174 26.6 Plus
Dvir\GJ16628-PA 304 GJ16628-PA 21..219 48..247 174 25.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19557-PA 362 GK19557-PA 1..271 1..271 929 58.7 Plus
Dwil\GK15836-PA 283 GK15836-PA 1..272 1..270 811 53.1 Plus
Dwil\GK18059-PA 311 GK18059-PA 1..275 1..276 739 47.5 Plus
Dwil\GK25153-PA 353 GK25153-PA 50..221 71..242 196 28.9 Plus
Dwil\GK10550-PA 272 GK10550-PA 39..214 71..247 177 27.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12802-PA 246 GE12802-PA 1..241 37..277 1128 85.5 Plus
Dyak\GE11586-PA 315 GE11586-PA 1..274 1..274 938 59.1 Plus
Dyak\Prosbeta5-PA 282 GE12841-PA 1..269 1..267 788 53.1 Plus
Dyak\GE25306-PA 324 GE25306-PA 38..225 59..247 197 31.1 Plus
Dyak\GE16434-PA 315 GE16434-PA 25..223 48..247 176 25.5 Plus

IP09987.hyp Sequence

Translation from 81 to 920

> IP09987.hyp
MALESICGMDKLPFMKSFGYRTSKQTIEEIRVASSNMDNPLAIMAPPYEN
PRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQ
SIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSA
AKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAVG
SGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHM
DQGNWRNVANKDCQELHEQYSGVGNQQTP*

IP09987.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5R2-PB 279 CG31742-PB 1..279 1..279 1467 100 Plus
Prosbeta5R2-PA 279 CG31742-PA 1..279 1..279 1467 100 Plus
Prosbeta5R1-PA 315 CG9868-PA 1..274 1..274 924 58.8 Plus
Prosbeta5-PA 282 CG12323-PA 1..279 1..277 775 51.8 Plus
Prosbeta5-PB 282 CG12323-PB 1..279 1..277 775 51.8 Plus