Clone IP10050 Report

Search the DGRC for IP10050

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:100
Well:50
Vector:pOT2
Associated Gene/TranscriptFRG1-RA
Protein status:IP10050.pep: gold
Preliminary Size:789
Sequenced Size:923

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6480 2005-01-01 Successful iPCR screen
CG6480 2008-04-29 Release 5.5 accounting
CG6480 2008-08-15 Release 5.9 accounting
CG6480 2008-12-18 5.12 accounting

Clone Sequence Records

IP10050.complete Sequence

923 bp (923 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023262

> IP10050.complete
CTCGTGCCGAATTCGGCACGAGCAAAACTATATCAACAATTTACCTATTT
TGTGACGATGTCAGACTACGATCATGCACGCATTAAGAAATTGGTTCTAA
AAGGCGAGAAACTCAAAAAGAGCAAAAAACGCAAGAAGGAAAAGGATGAG
GCTGGATCTTCCAAAAAGGCCAAGGTAGTAGTGGATGAGGATGCCGTGAA
GCACGGCGGTTGGTGGGCAGCAAAGACAGCGGCCGACATCACCGGTACAG
TGTCCATAGAGTTTGGCGATAGGAGTTACCTAAAGGCCATGGACAATGGT
CTCTTCACATTGGGAGCACCACACAACGCTGGCGATGGCCCAGATCCCGA
GGAGATTTTCACGGCTTTTCCCATCAACGACCGAAAGGTAGCGTTTAAGT
CTGGCTATGGCAAGTACTTGAAAATTGAGAAGGATGGAATGGTCACGGGG
CGCTCCGAAGCAGTGGGCGGCATGGAGCAGTGGGAGCCGGTTTTTGAGGA
ACAACGAATGGCTCTTCTATCCGAAACCGGACACTTTATGTCGATCGATC
CCCAAGACGACGCCTGCGTGGCATTGCGAAAGAAGGTGGGTCAGCATGAG
ATCTGTAAAGTGCGGAGTAATGCGAGCAGGGATGTGGTCATCGATACGGA
GCCCAAGGAAGAAAAGGGAGACTTGGGCGAAGTCGAGAAGAACTATGTGA
AAAAATTTCAAAAGTTCCAGGACAAGAAGATGCGGATTAATCAGAACGAT
GTCAAAGAACTCGAGCAGGCAAAAGCTCAGGGATCTTTGCATGAAACTCT
TCTGGATAGACGCAGTAAAATGAAAGCCGATCGGTATTGCAAGTAAACCG
ACGCGAAGTGTTCATCATTCATTAAAAAAAGTTACCTCTAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

IP10050.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6480-RA 1032 CG6480-RA 67..937 23..893 4355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20285209..20285411 699..497 1015 100 Minus
chr3L 24539361 chr3L 20285468..20285668 499..299 1005 100 Minus
chr3L 24539361 chr3L 20284927..20285117 889..699 955 100 Minus
chr3L 24539361 chr3L 20285732..20285914 299..117 915 100 Minus
chr3L 24539361 chr3L 20285967..20286060 116..23 470 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20296084..20296286 699..497 1015 100 Minus
3L 28110227 3L 20296343..20296543 499..299 1005 100 Minus
3L 28110227 3L 20295798..20295992 893..699 975 100 Minus
3L 28110227 3L 20296607..20296789 299..117 915 100 Minus
3L 28110227 3L 20296842..20296935 116..23 470 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20289184..20289386 699..497 1015 100 Minus
3L 28103327 3L 20289443..20289643 499..299 1005 100 Minus
3L 28103327 3L 20288898..20289092 893..699 975 100 Minus
3L 28103327 3L 20289707..20289889 299..117 915 100 Minus
3L 28103327 3L 20289942..20290035 116..23 470 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:26:35 has no hits.

IP10050.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:27:16 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20285469..20285667 300..498 100 <- Minus
chr3L 20285732..20285914 117..299 100 <- Minus
chr3L 20285967..20286060 23..116 100   Minus
chr3L 20284927..20285117 699..889 100 <- Minus
chr3L 20285210..20285409 499..698 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:44:54 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 1..789 58..846 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:15 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 1..789 58..846 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:40 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 1..789 58..846 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:55 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 1..789 58..846 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:19 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
FRG1-RA 1..789 58..846 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:05:10 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 1..867 23..889 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:15 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 1..867 23..889 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:40 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 37..903 23..889 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:55 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
CG6480-RA 1..789 58..846 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:19 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
FRG1-RA 37..903 23..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:16 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20296085..20296284 499..698 100 <- Minus
3L 20295802..20295992 699..889 100 <- Minus
3L 20296344..20296542 300..498 100 <- Minus
3L 20296607..20296789 117..299 100 <- Minus
3L 20296842..20296935 23..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:16 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20296085..20296284 499..698 100 <- Minus
3L 20295802..20295992 699..889 100 <- Minus
3L 20296344..20296542 300..498 100 <- Minus
3L 20296607..20296789 117..299 100 <- Minus
3L 20296842..20296935 23..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:16 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20296085..20296284 499..698 100 <- Minus
3L 20295802..20295992 699..889 100 <- Minus
3L 20296344..20296542 300..498 100 <- Minus
3L 20296607..20296789 117..299 100 <- Minus
3L 20296842..20296935 23..116 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:40 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20288902..20289092 699..889 100 <- Minus
arm_3L 20289185..20289384 499..698 100 <- Minus
arm_3L 20289444..20289642 300..498 100 <- Minus
arm_3L 20289707..20289889 117..299 100 <- Minus
arm_3L 20289942..20290035 23..116 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:08 Download gff for IP10050.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20288902..20289092 699..889 100 <- Minus
3L 20289185..20289384 499..698 100 <- Minus
3L 20289444..20289642 300..498 100 <- Minus
3L 20289707..20289889 117..299 100 <- Minus
3L 20289942..20290035 23..116 100   Minus

IP10050.hyp Sequence

Translation from 24 to 845

> IP10050.hyp
KLYQQFTYFVTMSDYDHARIKKLVLKGEKLKKSKKRKKEKDEAGSSKKAK
VVVDEDAVKHGGWWAAKTAADITGTVSIEFGDRSYLKAMDNGLFTLGAPH
NAGDGPDPEEIFTAFPINDRKVAFKSGYGKYLKIEKDGMVTGRSEAVGGM
EQWEPVFEEQRMALLSETGHFMSIDPQDDACVALRKKVGQHEICKVRSNA
SRDVVIDTEPKEEKGDLGEVEKNYVKKFQKFQDKKMRINQNDVKELEQAK
AQGSLHETLLDRRSKMKADRYCK*

IP10050.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
FRG1-PA 262 CG6480-PA 1..262 12..273 1365 100 Plus

IP10050.pep Sequence

Translation from 57 to 845

> IP10050.pep
MSDYDHARIKKLVLKGEKLKKSKKRKKEKDEAGSSKKAKVVVDEDAVKHG
GWWAAKTAADITGTVSIEFGDRSYLKAMDNGLFTLGAPHNAGDGPDPEEI
FTAFPINDRKVAFKSGYGKYLKIEKDGMVTGRSEAVGGMEQWEPVFEEQR
MALLSETGHFMSIDPQDDACVALRKKVGQHEICKVRSNASRDVVIDTEPK
EEKGDLGEVEKNYVKKFQKFQDKKMRINQNDVKELEQAKAQGSLHETLLD
RRSKMKADRYCK*

IP10050.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24475-PA 262 GF24475-PA 1..262 1..262 1136 89.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13330-PA 262 GG13330-PA 1..262 1..262 1356 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16969-PA 264 GH16969-PA 1..264 1..262 1041 81.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
FRG1-PA 262 CG6480-PA 1..262 1..262 1365 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11833-PA 264 GI11833-PA 1..264 1..262 1028 81.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25043-PA 262 GL25043-PA 1..262 1..262 1046 85.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19626-PA 262 GA19626-PA 1..262 1..262 1046 85.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22232-PA 262 GM22232-PA 1..262 1..262 1355 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12203-PA 262 GD12203-PA 1..262 1..262 1351 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13533-PA 264 GJ13533-PA 1..264 1..262 1036 81.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17238-PA 265 GK17238-PA 1..265 1..262 1078 80.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22419-PA 214 GE22419-PA 1..214 1..214 1104 97.2 Plus
Dyak\GE22948-PA 185 GE22948-PA 1..185 78..262 981 97.8 Plus
Dyak\GE22421-PA 129 GE22421-PA 1..81 1..81 391 96.3 Plus
Dyak\GE22421-PA 129 GE22421-PA 92..129 225..262 193 97.4 Plus