Clone IP10109 Report

Search the DGRC for IP10109

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:9
Vector:pOT2
Associated Gene/TranscriptCG32986-RA
Protein status:IP10109.pep: gold
Preliminary Size:873
Sequenced Size:991

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32986 2005-01-01 Successful iPCR screen
CG32986 2008-04-29 Release 5.5 accounting
CG32986 2008-08-15 Release 5.9 accounting
CG32986 2008-12-18 5.12 accounting

Clone Sequence Records

IP10109.complete Sequence

991 bp (991 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023294

> IP10109.complete
ATTTTAAGTGGTTGCCCTCTAAGTGCTCCCAATGTTAGGAGGCAGTTTAA
GAAATGACTGGGTCATCTATCCACCAGCCCTCCAGCTTCTCAACTTTCCT
TTGCCACAGCAGCAAGAGCAGGCTCCTGGAACTTTGGTTCGATACGAGCA
TCCTTCGATACACCAGCTTCGCTTAGCACCCCGTAGATTAAGGGCACGAC
GTTCGGTTGTGGAAGGCGAAGGCTCCAGAGGACTGGACAACGGAAATGGC
GACTCGTCGAAAATAATATTTGTGCGGCGCTGCTACATGATGGCTGGATT
GTTTTCGACTACAACTGCGATCCTTGCCATAATCCTGTCCAAGGTAATTC
CTCCGGAGGCAGATCTTATAATGGCAGGATTCATAAGTGCAATGGTGTCC
CTAATGTTTCTCTTTGTCTTCTGTATTTTGACCAAGTTGCGGAGTTTTTA
TTGGTATAGTTTCATCATGGCCGGGTTGTTTGTAAGTCTGGCAGGTTTGG
GCGTTATTCTGCTTCTCCTGGAGCGGAACCTTTCCCGCGTGTGCATTGCC
CTTCTGGTGGCCTCCGCCATGACTGTGATATGCTATTTCGCTGGCGCATG
GATACCCAAGATCATCCTCCCCGGAGAGAGGACCATGTTCCTCCTGCTCG
TCATTTTCGTGATGTCCTCAATCTTTGTGATGACCATGTATATCTTCACA
GACAATTGGATCTACCAGTTGGTGTACTTCACGTTATTGGCCACTTTGCT
AATACCCGCATCCGTTTACCATGCTCAGGTGGTTCATTCCAGGCGATTCC
AGCTGCCCGATTACGAATTCGTTATTTGCGCCGTCAACATCTATCTGCAC
TTTCTGTTGTTCTTTGCGGCCTTTTACTTTGTCATCTGGGCTCCCAAATG
GTGAGAGTTATAGGAGTTAATTTAACGTGTCCGTGTAAAATAAAAAGAAG
GCTTTAATGAGAAAAGATAAAAAAAAAAAAAAAAAAAAAAA

IP10109.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG32986-RA 961 CG32986-RA 1..961 1..961 4805 100 Plus
CG32986.a 868 CG32986.a 339..868 432..961 2650 100 Plus
CG32986.a 868 CG32986.a 1..343 1..343 1715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8861684..8862651 1..968 4825 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8862776..8863744 1..969 4845 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8862776..8863744 1..969 4845 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:48:11 has no hits.

IP10109.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:48:55 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8861684..8862651 1..968 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:08 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..873 32..904 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:09 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..873 32..904 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:58:39 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..873 32..904 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:01:33 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..873 32..904 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:03:12 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..873 32..904 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:16:36 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..873 32..904 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:08 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..968 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:58:39 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..968 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:23 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..873 32..904 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:03:12 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
CG32986-RA 1..968 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:55 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8862776..8863743 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:55 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8862776..8863743 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:55 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8862776..8863743 1..968 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:58:39 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8862776..8863743 1..968 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:14 Download gff for IP10109.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8862776..8863743 1..968 100   Plus

IP10109.hyp Sequence

Translation from 31 to 903

> IP10109.hyp
MLGGSLRNDWVIYPPALQLLNFPLPQQQEQAPGTLVRYEHPSIHQLRLAP
RRLRARRSVVEGEGSRGLDNGNGDSSKIIFVRRCYMMAGLFSTTTAILAI
ILSKVIPPEADLIMAGFISAMVSLMFLFVFCILTKLRSFYWYSFIMAGLF
VSLAGLGVILLLLERNLSRVCIALLVASAMTVICYFAGAWIPKIILPGER
TMFLLLVIFVMSSIFVMTMYIFTDNWIYQLVYFTLLATLLIPASVYHAQV
VHSRRFQLPDYEFVICAVNIYLHFLLFFAAFYFVIWAPKW*

IP10109.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG32986-PA 290 CG32986-PA 1..290 1..290 1492 100 Plus

IP10109.pep Sequence

Translation from 31 to 903

> IP10109.pep
MLGGSLRNDWVIYPPALQLLNFPLPQQQEQAPGTLVRYEHPSIHQLRLAP
RRLRARRSVVEGEGSRGLDNGNGDSSKIIFVRRCYMMAGLFSTTTAILAI
ILSKVIPPEADLIMAGFISAMVSLMFLFVFCILTKLRSFYWYSFIMAGLF
VSLAGLGVILLLLERNLSRVCIALLVASAMTVICYFAGAWIPKIILPGER
TMFLLLVIFVMSSIFVMTMYIFTDNWIYQLVYFTLLATLLIPASVYHAQV
VHSRRFQLPDYEFVICAVNIYLHFLLFFAAFYFVIWAPKW*

IP10109.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15547-PA 137 GF15547-PA 3..128 162..287 219 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25306-PA 290 GG25306-PA 1..290 1..290 1207 80.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13866-PA 277 GH13866-PA 12..276 11..290 361 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32986-PA 290 CG32986-PA 1..290 1..290 1492 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17418-PA 275 GI17418-PA 1..275 1..290 380 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28038-PA 330 GA28038-PA 39..323 10..286 435 35.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17173-PA 289 GM17173-PA 1..289 1..290 1384 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23567-PA 289 GD23567-PA 1..289 1..290 1397 92.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18353-PA 274 GJ18353-PA 1..274 1..290 426 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24521-PA 270 GK24521-PA 8..256 15..274 479 38.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18796-PA 292 GE18796-PA 1..292 1..290 1101 79.5 Plus