Clone IP10110 Report

Search the DGRC for IP10110

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:10
Vector:pOT2
Associated Gene/TranscriptCG32987-RA
Protein status:IP10110.pep: gold
Preliminary Size:787
Sequenced Size:1101

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32987 2005-01-01 Successful iPCR screen
CG32987 2008-04-29 Release 5.5 accounting
CG32987 2008-08-15 Release 5.9 accounting
CG32987 2008-12-18 5.12 accounting

Clone Sequence Records

IP10110.complete Sequence

1101 bp (1101 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024336

> IP10110.complete
CCAGACCTAGTCTTAACACTCGGTCCATAAGGATTTTTAACGGGATGGAC
AACATTTACCACCAGGACAACATCCGGCCGACGATCGAGCAGCTGGACCC
AATGACCCAGTTCATCCGCAGCATCTATAACATTGGCCTGATCCTTATCG
GAATTACGGTGGGCGCATGGATTCTGCTCATGCTGACCCATATTCACCTG
CAGAGGTACCTTCCGTTTCCCTGCTACGTCCTGGCTCTAATAATTTTTCT
GGTGATGATATGCATGCATTGTATCCCGAGAATATCCTACTACTCTCCCT
GTAAGTGGTTCATGACAGGTCTGGTGGTTGTGTGTACCACCTTGTTTGGC
TGCCATTTCATCCACGACTTGAGCCCGCTCATTATCAGTTTCGTGATGAT
CGGCGTGGCCCTGATCATTATGTTACTCAACTTCTCTGGGGCCATGTGCC
CGCAGGAGTTCCTGCCCGGCGGTGTTTGCTCCACGCTGCTGATGATGGCA
CTGCTGTTGGTCTTGACCATTGTGGGAATCGTCCAGCTCTGCACCGGGAG
TGTTGAGCTGCTCGACACCTTCGTCAGCATTCTGTTCCTGATGCTGATCA
TAGCGATCCCCATTCAGGCGCAGTTCAACCATGGCCGTCTGAACGTCGTG
GAAGTGGTTCCCGAAGAGCACCTCATGGTCTGCACCCTGACTTTATACTT
GCATTCAATGATGTTCTTCTTCTGCGTGTGCTACTTCATCCTGGTCGACG
AGAGAAAGGAGGCCATCAGACAAACATCTGAAGCTCCGAAAATTTCACTC
GAAAATGATTTTGATTGAGAGAAATAGCTGTCACTGTGTGATCGAAACTG
ATTAGCGATCTGGCAAGTTACTATGGTGTTCCAGACCAAAGGATACTGTC
ATCCAGTCTAATTACTTAGTGCGGTGTAGCCTAGGCGGTACAGAAAATAT
AAATATATTCTCATTGCAAGGCAATTAGAATAAAGCCAGAGTATTATGAA
AAGTCCTAGTCTCAATATAAGAGAAAATGAATCACTTAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

IP10110.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32987-RA 1037 CG32987-RA 1..1037 1..1037 5185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8862719..8863755 1..1037 5080 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8863811..8864848 1..1038 5190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8863811..8864848 1..1038 5190 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:16:25 has no hits.

IP10110.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:17:28 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8862719..8863755 1..1037 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:09 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..774 45..818 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:35:35 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..774 45..818 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:57 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..774 45..818 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:13 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..774 45..818 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:33:50 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..774 45..818 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:04 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..787 32..818 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:35:35 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..1037 1..1037 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:57 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..1037 1..1037 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:13 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..787 32..818 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:33:50 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
CG32987-RA 1..1037 1..1037 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:28 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8863811..8864847 1..1037 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:28 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8863811..8864847 1..1037 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:28 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8863811..8864847 1..1037 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:57 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8863811..8864847 1..1037 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:21 Download gff for IP10110.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8863811..8864847 1..1037 100   Plus

IP10110.hyp Sequence

Translation from 2 to 817

> IP10110.hyp
RPSLNTRSIRIFNGMDNIYHQDNIRPTIEQLDPMTQFIRSIYNIGLILIG
ITVGAWILLMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIPRISYYSPC
KWFMTGLVVVCTTLFGCHFIHDLSPLIISFVMIGVALIIMLLNFSGAMCP
QEFLPGGVCSTLLMMALLLVLTIVGIVQLCTGSVELLDTFVSILFLMLII
AIPIQAQFNHGRLNVVEVVPEEHLMVCTLTLYLHSMMFFFCVCYFILVDE
RKEAIRQTSEAPKISLENDFD*

IP10110.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG32987-PA 257 CG32987-PA 1..257 15..271 1344 100 Plus
CG32983-PA 250 CG32983-PA 22..226 37..245 257 28.9 Plus
CG32988-PA 255 CG32988-PA 41..248 37..247 204 22.3 Plus

IP10110.pep Sequence

Translation from 44 to 817

> IP10110.pep
MDNIYHQDNIRPTIEQLDPMTQFIRSIYNIGLILIGITVGAWILLMLTHI
HLQRYLPFPCYVLALIIFLVMICMHCIPRISYYSPCKWFMTGLVVVCTTL
FGCHFIHDLSPLIISFVMIGVALIIMLLNFSGAMCPQEFLPGGVCSTLLM
MALLLVLTIVGIVQLCTGSVELLDTFVSILFLMLIIAIPIQAQFNHGRLN
VVEVVPEEHLMVCTLTLYLHSMMFFFCVCYFILVDERKEAIRQTSEAPKI
SLENDFD*

IP10110.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15548-PA 251 GF15548-PA 1..248 1..247 694 54.8 Plus
Dana\GF15549-PA 298 GF15549-PA 72..289 23..249 196 23.4 Plus
Dana\GF19717-PA 254 GF19717-PA 39..253 22..242 181 25.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25307-PA 257 GG25307-PA 1..257 1..257 1063 80.9 Plus
Dere\GG25308-PA 252 GG25308-PA 35..243 20..231 163 25.4 Plus
Dere\GG25309-PA 250 GG25309-PA 5..226 6..231 155 26.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13867-PA 240 GH13867-PA 5..227 6..231 293 30.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG32987-PA 257 CG32987-PA 1..257 1..257 1344 100 Plus
CG32983-PA 250 CG32983-PA 22..226 23..231 257 28.9 Plus
CG32988-PA 255 CG32988-PA 41..248 23..233 204 22.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17419-PA 320 GI17419-PA 76..304 2..233 188 28.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25571-PA 266 GL25571-PA 24..264 15..255 523 47.1 Plus
Dper\GL25572-PA 250 GL25572-PA 1..242 1..231 239 28.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17228-PA 266 GA17228-PA 24..264 15..255 523 47.1 Plus
Dpse\GA17229-PA 250 GA17229-PA 1..242 1..231 239 28.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17184-PA 257 GM17184-PA 1..257 1..257 1196 92.6 Plus
Dsec\GM17206-PA 250 GM17206-PA 22..226 23..231 194 28.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23568-PA 257 GD23568-PA 1..257 1..257 1200 93 Plus
Dsim\GD23570-PA 250 GD23570-PA 22..226 23..231 198 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18354-PA 262 GJ18354-PA 42..247 23..231 224 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24532-PA 249 GK24532-PA 9..244 6..238 540 47.5 Plus
Dwil\GK24533-PA 270 GK24533-PA 40..270 20..255 285 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18797-PA 257 GE18797-PA 1..257 1..257 1007 77 Plus
Dyak\GE18799-PA 250 GE18799-PA 5..233 7..238 163 29.3 Plus