Clone IP10114 Report

Search the DGRC for IP10114

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:14
Vector:pOT2
Associated Gene/TranscriptCG33127-RA
Protein status:IP10114.pep: gold
Preliminary Size:855
Sequenced Size:991

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33127 2005-01-01 Successful iPCR screen
CG33127 2008-04-29 Release 5.5 accounting
CG33127 2008-08-15 Release 5.9 accounting
CG33127 2008-12-18 5.12 accounting

Clone Sequence Records

IP10114.complete Sequence

991 bp (991 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023298

> IP10114.complete
CCGTATCAGTGATGTTATCGCCGCTTTTCCTGCTGCCCCTCTTGGCTTTG
GCCGGAGCGGCTAAACTTCCGCACATTCAACACCTGACATTGAGGGATAC
AGAACAAGTTCACGCAGAGATCCAGCCCCTGATTATAGATGGCTACGATG
TGCAGGGGGTGGACAATGTGCCCTACCTGGTGTCCCTGTCCTTGACAAGG
GCCACCTATACCCACTTGTGCGGGGCATCCATCATTGGCAAACGATGGCT
CCTGACGGCTGCTCATTGTGTCGATGAACTGCGCACCTTCAACGGAGATG
CCGTAGGAACACCCGTTTACGCTGGAATCATCAACCGGTCGAACGTGACG
GCCGCCCAAGTGCGCTACGTCGACTTCGCCTCAACGCATCGGTCTTTCAA
TGGAAACGCCGGAAGTGACAATATAGCCTTGCTCCACGTCTCTGAGAGCT
TCGAGTACAACGCTCGAGTTCAGCAGATCGCCCTGCCCGACATCAATGAT
GATTACAGCAATAAGACAGCTGCTGCTTATGGCTGGGGACTCACCGACCC
CGATGGCGACGAGTACTCCAAAGAGTTGCAGTATGCCTTCGCTCCCCTAC
TCAATAGCACGGGTTGCAAGGAGTTGCTGCCCGCAGACGCTCCTCTGACG
GCGCAGCAGGTGTGCTCTCAGGTAAAGACCTGCTACGGAGACGGAGGCAC
TCCCCTGATCTACTGGCCCATCACTGGACCGGCGGAGTTGGTGGGCCTCG
GATCCTGGAGCTATATGCCGTGCGGATATGCCAATCGGCCAACGGTGTAC
ACCTCTGTACCCCCTTACATTGGATGGATCCACCAAACGATCGGCGCCTA
CTACCAGCTTAACTGAGAGTCGTGGTGTCGAAGGGGAGATCTTTGCGTAA
TACTCTAGCAGTACATTAAAGTAAACACCGCGCGTTTTCGTATCTTATCA
CAGAGCTCGTTAACGTGAATAGAAAAAAAAAAAAAAAAAAA

IP10114.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG33127-RA 855 CG33127-RA 1..855 12..866 4275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 322155..323122 5..972 4840 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:00:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 322120..323095 1..976 4880 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 322120..323095 1..976 4880 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:08:02 has no hits.

IP10114.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:08:54 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 322151..323122 1..972 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:11 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 1..855 12..866 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:37:58 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 1..855 12..866 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:38 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 1..855 12..866 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:14:28 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 1..855 12..866 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:20:19 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 1..855 12..866 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:42:15 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 1..855 12..866 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:37:58 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 20..991 1..972 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:38 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 20..991 1..972 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:14:28 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 1..855 12..866 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:20:19 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
CG33127-RA 20..991 1..972 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:54 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 322120..323091 1..972 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:54 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 322120..323091 1..972 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:54 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 322120..323091 1..972 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:38 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 322120..323091 1..972 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:39 Download gff for IP10114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 322120..323091 1..972 100   Plus

IP10114.hyp Sequence

Translation from 2 to 865

> IP10114.hyp
VSVMLSPLFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDV
QGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDA
VGTPVYAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESF
EYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLL
NSTGCKELLPADAPLTAQQVCSQVKTCYGDGGTPLIYWPITGPAELVGLG
SWSYMPCGYANRPTVYTSVPPYIGWIHQTIGAYYQLN*

IP10114.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG33127-PA 284 CG33127-PA 1..284 4..287 1516 100 Plus
CG11911-PA 277 CG11911-PA 26..276 38..286 451 37.8 Plus
yip7-PA 270 CG6457-PA 3..269 8..281 281 30.7 Plus
CG7142-PA 334 CG7142-PA 90..327 55..280 260 28 Plus
CG10472-PA 290 CG10472-PA 36..284 35..281 256 29.7 Plus

IP10114.pep Sequence

Translation from 11 to 865

> IP10114.pep
MLSPLFLLPLLALAGAAKLPHIQHLTLRDTEQVHAEIQPLIIDGYDVQGV
DNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGT
PVYAGIINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYN
ARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNST
GCKELLPADAPLTAQQVCSQVKTCYGDGGTPLIYWPITGPAELVGLGSWS
YMPCGYANRPTVYTSVPPYIGWIHQTIGAYYQLN*

IP10114.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24871-PA 277 GF24871-PA 20..276 28..283 404 36.8 Plus
Dana\GF24882-PA 267 GF24882-PA 22..260 38..275 270 30.7 Plus
Dana\GF10666-PA 268 GF10666-PA 1..267 5..278 254 30.9 Plus
Dana\GF23147-PA 335 GF23147-PA 91..334 52..283 254 26.9 Plus
Dana\GF10664-PA 270 GF10664-PA 7..267 7..278 245 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24657-PA 277 GG24657-PA 26..276 35..283 439 38.2 Plus
Dere\GG24658-PA 273 GG24658-PA 32..268 41..275 281 34 Plus
Dere\GG16564-PA 334 GG16564-PA 90..333 52..283 254 27.3 Plus
Dere\GG15305-PA 270 GG15305-PA 3..269 5..278 253 30 Plus
Dere\GG14091-PA 290 GG14091-PA 47..284 42..278 248 30.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22535-PA 277 GH22535-PA 30..276 39..283 429 38 Plus
Dgri\GH11151-PA 277 GH11151-PA 30..276 39..283 429 38 Plus
Dgri\GH22534-PA 277 GH22534-PA 30..276 39..283 418 37.3 Plus
Dgri\GH11150-PA 277 GH11150-PA 30..276 39..283 406 36.5 Plus
Dgri\GH14063-PA 285 GH14063-PA 80..279 69..277 278 35.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG33127-PA 284 CG33127-PA 1..284 1..284 1516 100 Plus
CG11911-PA 277 CG11911-PA 26..276 35..283 451 37.8 Plus
yip7-PA 270 CG6457-PA 3..269 5..278 281 30.7 Plus
CG7142-PA 334 CG7142-PA 90..327 52..277 260 28 Plus
CG10472-PA 290 CG10472-PA 36..284 32..278 256 29.7 Plus
CG11912-PA 271 CG11912-PA 30..266 41..275 253 31.9 Plus
Phae1-PB 270 CG16996-PB 44..263 50..273 251 29.6 Plus
Phae1-PA 270 CG16996-PA 44..263 50..273 251 29.6 Plus
Jon65Aiii-PA 274 CG6483-PA 11..274 11..281 235 28.2 Plus
CG31266-PB 282 CG31266-PB 7..276 2..277 234 31.5 Plus
Jon65Aiv-PA 271 CG6467-PA 4..270 5..278 229 28.3 Plus
Phae2-PC 265 CG16997-PC 34..259 44..273 226 28.5 Plus
Phae2-PB 265 CG16997-PB 34..259 44..273 226 28.5 Plus
CG10477-PB 272 CG10477-PB 19..272 27..281 225 28.4 Plus
CG10477-PA 272 CG10477-PA 19..272 27..281 225 28.4 Plus
Np-PB 1041 CG34350-PB 795..1039 38..277 224 26.8 Plus
Np-PA 1041 CG34350-PA 795..1039 38..277 224 26.8 Plus
CG3355-PA 314 CG3355-PA 76..313 41..282 223 28.4 Plus
CG17477-PA 267 CG17477-PA 23..251 37..277 221 29 Plus
CG31267-PA 275 CG31267-PA 45..269 42..277 218 29.6 Plus
CG32808-PA 284 CG32808-PA 37..262 49..280 218 29.3 Plus
CG33160-PA 258 CG33160-PA 29..254 36..277 216 27.2 Plus
CG8299-PA 260 CG8299-PA 28..259 42..280 214 29.8 Plus
Jon99Ci-PA 272 CG31039-PA 6..272 5..281 214 27.1 Plus
CG11836-PI 281 CG11836-PI 52..274 49..277 214 26.5 Plus
CG11836-PJ 333 CG11836-PJ 104..326 49..277 214 26.5 Plus
CG11836-PF 223 CG11836-PF 12..216 70..277 213 27.7 Plus
CG11836-PE 223 CG11836-PE 12..216 70..277 213 27.7 Plus
CG11836-PG 223 CG11836-PG 12..216 70..277 213 27.7 Plus
CG11836-PC 223 CG11836-PC 12..216 70..277 213 27.7 Plus
CG11836-PA 223 CG11836-PA 12..216 70..277 213 27.7 Plus
CG11836-PB 223 CG11836-PB 12..216 70..277 213 27.7 Plus
CG11192-PB 279 CG11192-PB 28..265 42..279 213 27.3 Plus
Jon74E-PC 271 CG6298-PC 32..270 42..281 210 26.9 Plus
teq-PD 1450 CG4821-PD 1232..1443 67..277 210 31.2 Plus
teq-PF 2379 CG4821-PF 2161..2372 67..277 210 31.2 Plus
Jon99Cii-PA 265 CG31034-PA 3..265 5..281 209 29.9 Plus
Jon99Ciii-PB 265 CG31362-PB 3..265 5..281 209 29.9 Plus
Jon99Ciii-PA 265 CG31362-PA 3..265 5..281 209 29.9 Plus
CG6041-PA 308 CG6041-PA 24..271 30..275 209 27.1 Plus
Jon99Fii-PA 267 CG2229-PA 3..267 5..281 208 29.3 Plus
CG16749-PA 265 CG16749-PA 30..260 41..276 206 29.6 Plus
CG31954-PA 277 CG31954-PA 14..276 10..278 206 27.4 Plus
CG7829-PA 253 CG7829-PA 26..249 39..277 203 28.6 Plus
Jon99Fi-PA 267 CG18030-PA 3..267 5..281 203 28.9 Plus
betaTry-PB 253 CG18211-PB 27..249 42..273 202 27.1 Plus
betaTry-PA 253 CG18211-PA 27..249 42..273 202 27.1 Plus
alphaTry-PA 256 CG18444-PA 27..252 42..276 202 26.7 Plus
CG7542-PB 270 CG7542-PB 22..267 36..280 202 25.7 Plus
CG7542-PA 270 CG7542-PA 22..267 36..280 202 25.7 Plus
Jon66Ci-PA 260 CG7118-PA 5..260 8..281 201 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17855-PA 278 GI17855-PA 36..278 40..284 444 39.8 Plus
Dmoj\GI12958-PA 279 GI12958-PA 46..276 41..278 260 29.8 Plus
Dmoj\GI24439-PA 287 GI24439-PA 11..282 2..279 250 32.4 Plus
Dmoj\GI16676-PA 273 GI16676-PA 1..273 5..281 247 28.1 Plus
Dmoj\GI23092-PA 326 GI23092-PA 82..321 52..279 244 27 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19275-PA 277 GL19275-PA 8..276 6..283 442 37.5 Plus
Dper\GL22122-PA 336 GL22122-PA 94..331 54..279 272 28 Plus
Dper\GL25036-PA 263 GL25036-PA 30..260 41..278 246 30.2 Plus
Dper\GL19276-PA 271 GL19276-PA 30..269 41..280 242 33.5 Plus
Dper\GL15524-PA 270 GL15524-PA 55..267 68..279 240 30 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17302-PB 285 GA17302-PB 1..285 1..284 1189 77.2 Plus
Dpse\GA11277-PA 277 GA11277-PA 8..276 6..283 440 37.2 Plus
Dpse\GA20132-PA 336 GA20132-PA 94..331 54..279 269 28 Plus
Dpse\GA25897-PA 271 GA25897-PA 30..269 41..280 247 33.9 Plus
Dpse\GA23594-PA 263 GA23594-PA 30..260 41..278 245 30.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16677-PA 277 GM16677-PA 26..276 35..283 459 39.8 Plus
Dsec\GM16678-PA 271 GM16678-PA 30..266 41..275 266 33.1 Plus
Dsec\GM15310-PA 334 GM15310-PA 90..333 52..283 253 27.3 Plus
Dsec\GM13874-PA 290 GM13874-PA 8..284 5..278 243 27.9 Plus
Dsec\GM13877-PA 272 GM13877-PA 2..272 4..281 238 28.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22965-PA 277 GD22965-PA 26..276 35..283 452 39.4 Plus
Dsim\GD13160-PA 272 GD13160-PA 5..271 5..280 264 29.6 Plus
Dsim\GD22966-PA 271 GD22966-PA 30..266 41..275 258 32.7 Plus
Dsim\GD20188-PA 334 GD20188-PA 90..333 52..283 253 27.3 Plus
Dsim\GD13158-PA 290 GD13158-PA 8..284 5..278 250 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17354-PA 277 GJ17354-PA 26..276 35..283 448 39.8 Plus
Dvir\GJ17353-PA 277 GJ17353-PA 26..277 35..284 446 38.1 Plus
Dvir\GJ20009-PA 271 GJ20009-PA 47..271 54..281 257 30.7 Plus
Dvir\GJ22712-PA 326 GJ22712-PA 82..325 52..283 247 26.9 Plus
Dvir\GJ17355-PA 269 GJ17355-PA 30..264 41..275 242 29.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23887-PA 278 GK23887-PA 27..277 35..283 431 37.1 Plus
Dwil\GK18044-PA 273 GK18044-PA 40..273 41..281 249 30 Plus
Dwil\GK22780-PA 335 GK22780-PA 91..334 52..283 247 26.9 Plus
Dwil\GK22079-PA 257 GK22079-PA 11..253 25..281 244 28.6 Plus
Dwil\GK23888-PA 268 GK23888-PA 42..266 54..277 241 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16206-PA 277 GE16206-PA 3..276 1..283 447 36.5 Plus
Dyak\GE20517-PA 272 GE20517-PA 6..269 5..278 261 31.3 Plus
Dyak\GE25219-PA 334 GE25219-PA 90..333 52..283 258 27.3 Plus
Dyak\GE20514-PA 290 GE20514-PA 8..284 5..278 246 28.2 Plus
Dyak\GE16217-PA 271 GE16217-PA 30..266 41..275 241 30.3 Plus