Clone IP10117 Report

Search the DGRC for IP10117

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:17
Vector:pOT2
Associated Gene/TranscriptPex12-RA
Protein status:IP10117.pep: gold
Preliminary Size:894
Sequenced Size:1057

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3639 2005-01-01 Successful iPCR screen
CG3639 2008-04-29 Release 5.5 accounting
CG3639 2008-08-15 Release 5.9 accounting
CG3639 2008-12-18 5.12 accounting

Clone Sequence Records

IP10117.complete Sequence

1057 bp (1057 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023302

> IP10117.complete
AGAATAACAACATAATTGGTATTCGAATTTAATTCCATTTATTTAAATGC
TATAAACACAATGGCAGAAGCGGCAAATGTGCGCCAGAACCTTCAAAATG
TGCCGTCGATCTTCGAAATTTCAGCGTCAGAGACGCTGGACAACCTGATT
TACCCGGCACTGAGCAAGATATTCGACTACTTTGGACTACGCCTGGACTT
TAAACTATGGGGGAGTTTGAGGATTCAGGAGGAGCTGTCGCCATTGCTGA
CTTGGCTGCTGCAGTACCTGTATCTGCGCAAGAGGGCCTCCTCTTTCGGT
GAGAGCTTTTACGGATTGCAAAGGACGGTCACAACCACTGGGGATCTGCT
GAACCGCAGGCAGCAGTTCGCCTCTGCCACACTGCTAACCTTCATGCCTT
ACGTGGAGCGGAAGCTAAGGACCAGGATCACCAGGCACGAGGACACCAGT
CCCTGGGAGCAACGCCTTCTAAGCGCATTCCATGCTTTCCATGCCGCCAA
GGCGGCGCACACATTCTTTTACCTCGTAAAGTACGCCTCAAACCACTCGC
CCATCTTCAGATTGTTGGGGCTGACCCTTCGCTATCCCAGCGAACCTCCC
AAAGAGGATCAGTGGACCTACGTGGTCCTAAAGATGCTGGAGGTCTTGGC
CTTCTTCCTGCAGTTCGTCCAGTGGTGGTACTCCAACGACCAGCGGCGGA
AAGTGGGTGGAACTCTGATAAATCCCGAAGCGATGCCGAGAAAGCAGCTG
CCCAAGGAAGTGCAGCAGAGCCTTCCCCAGCGGGGAGAGTGCCCAGTCTG
CCTGCTGTCCATCCAGACGCCCACTGCCTGCTCCGTTTCCGGCTACGTCT
TTTGCTGGAAGTGCATCGTTAGCCACATGAAGGAGCACGGCACCTGCCCG
GTCACCCACTATCCCATCAGTCTGGACGACCTGGTGCGCATCTACGAGAC
GTAACGTTAAGCATTCCTTTTATGTTTTTTGCTTGTTTTTGTTTAATACA
TTTTATAAGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAA

IP10117.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG3639-RA 1010 CG3639-RA 1..1010 1..1010 5050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 815894..816903 1..1010 4975 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 816023..817034 1..1012 5060 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 816023..817034 1..1012 5060 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:09:00 has no hits.

IP10117.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:09:45 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 815894..816903 1..1010 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:14 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3639-RA 1..894 61..954 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:19 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
pex12-RA 1..894 61..954 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:57 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
Pex12-RA 1..894 61..954 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:58 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3639-RA 1..894 61..954 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:01:38 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
Pex12-RA 1..894 61..954 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:05:16 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3639-RA 1..894 61..954 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:19 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
pex12-RA 1..1010 1..1010 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:57 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
Pex12-RA 31..1040 1..1010 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:59 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3639-RA 1..894 61..954 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:01:38 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
Pex12-RA 31..1040 1..1010 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:45 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
2L 816023..817032 1..1010 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:45 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
2L 816023..817032 1..1010 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:45 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
2L 816023..817032 1..1010 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:57 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 816023..817032 1..1010 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:12 Download gff for IP10117.complete
Subject Subject Range Query Range Percent Splice Strand
2L 816023..817032 1..1010 100   Plus

IP10117.pep Sequence

Translation from 60 to 953

> IP10117.pep
MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLW
GSLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRR
QQFASATLLTFMPYVERKLRTRITRHEDTSPWEQRLLSAFHAFHAAKAAH
TFFYLVKYASNHSPIFRLLGLTLRYPSEPPKEDQWTYVVLKMLEVLAFFL
QFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLS
IQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET*

IP10117.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15076-PA 297 GF15076-PA 1..297 1..297 1384 87.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24747-PA 297 GG24747-PA 1..297 1..297 1556 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11244-PA 297 GH11244-PA 1..297 1..297 1294 78.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Pex12-PB 297 CG3639-PB 1..297 1..297 1574 100 Plus
Pex12-PA 297 CG3639-PA 1..297 1..297 1574 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21846-PA 297 GI21846-PA 1..297 1..297 1312 76.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19498-PA 297 GL19498-PA 1..297 1..297 1341 80.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17579-PA 297 GA17579-PA 1..297 1..297 1338 80.8 Plus
Dpse\GA27671-PA 293 GA27671-PA 1..293 1..297 1268 78.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16769-PA 297 GM16769-PA 1..297 1..297 1561 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23049-PA 186 GD23049-PA 1..186 112..297 982 96.2 Plus
Dsim\GD23048-PA 108 GD23048-PA 1..104 1..104 529 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17796-PA 297 GJ17796-PA 1..297 1..297 1302 76.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24633-PA 300 GK24633-PA 1..300 1..297 1288 78.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17100-PA 297 GE17100-PA 1..297 1..297 1553 97 Plus

IP10117.hyp Sequence

Translation from 60 to 953

> IP10117.hyp
MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLW
GSLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRR
QQFASATLLTFMPYVERKLRTRITRHEDTSPWEQRLLSAFHAFHAAKAAH
TFFYLVKYASNHSPIFRLLGLTLRYPSEPPKEDQWTYVVLKMLEVLAFFL
QFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLS
IQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET*

IP10117.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Pex12-PB 297 CG3639-PB 1..297 1..297 1574 100 Plus
Pex12-PA 297 CG3639-PA 1..297 1..297 1574 100 Plus