Clone IP10137 Report

Search the DGRC for IP10137

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:37
Vector:pOT2
Associated Gene/TranscriptCG4815-RA
Protein status:IP10137.pep: gold
Preliminary Size:798
Sequenced Size:1121

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4815 2005-01-01 Successful iPCR screen
CG4815 2008-04-29 Release 5.5 accounting
CG4815 2008-08-15 Release 5.9 accounting
CG4815 2008-12-18 5.12 accounting

Clone Sequence Records

IP10137.complete Sequence

1121 bp (1121 high quality bases) assembled on 2006-04-14

GenBank Submission: BT025111

> IP10137.complete
ACAAGTATCCATACTGTATACAAAAGTCATTGTACTTAGATCTTCAAAAA
ACCTATTGCAATTTACCATAAATAATACAGAACACTTTTTGTAGTCACTG
TAGACTTTTCTCGTGGAACGAATCAATTTCGAGCCATTCAAAGAAACTGT
TCTGAGAATGTAAGCCCATCATTTGCTCTTCAAAAGCCATGGAATCAGGT
TGGACACTCGTTCGGCTGCTGTTAATTCTAAATTCCGTGAGAACAGAAGC
TGGGAATAGAGAGGAGTGGACTGGCAGGTTCCATCCCAGGATTTATAATG
GCATAAAGACGACTGTCGAATCTCTTGGAGGAGTGGGCATTCAGCTCTTC
AATGGGAGAAAGCTCGTCTGCTCCGCAACACTTCTAACACCGCGACACAT
CCTTACGGCAGCCCATTGTTTCGAAAACCTGAATAGGTCTAAGTTCCACG
TGATCGGTGGAAAGTCAGCGGAATTCACTTGGCACGGCAACAACTTCAAC
AAGAATAAACTTATAAGGGTGCAAATTCATCCGAAATATGCGAAAATGAA
ATTCATCGCGGATGTCGCGGTGGCGAAGACCAAGTATCCCTTGAGGAGCA
AGTACATCGGCTACGCCCAGCTCTGTCGATCGGTACTGCATCCAAGGGAT
AAACTCATTGCAGCCGGTTGGGGATTCGAAGGCGGCGTTTGGGATGAGTC
CAGGAAGAAAACATTTCGCTCGATGAAAGTTGGTATTGTGAGTAAACGAG
ATTGCGAGAAGCAGCTGGATCGCAAGATGCCACCCAATATCATCTGTGCC
GGTGCCTACAACAACAAGACTCTCTGCTTCGGCGACTCCGGTGGACCACT
TCTGTTGGGGCGGCAAGTTTGTGGCATCAACACGTGGACTTTCAAATGCG
GCAACAACGAAAAGCCAGACGTATACATGGGTGTGCGATACTACGCCAAG
TTTATTAAAAGAACTATTAACAGAATGGGCTTTTGAAGAAATTTATTTGA
GTATCACAAAATAAAAATACTGTCTATCTAAGTTTACAACTTAGTCATAA
ATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

IP10137.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4815-RA 1053 CG4815-RA 1..1053 1..1053 5265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23812654..23813706 1053..1 5265 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27989696..27990751 1056..1 5280 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27730527..27731582 1056..1 5280 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:56:44 has no hits.

IP10137.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:57:34 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23812654..23813706 1..1053 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:19 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..798 189..986 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:35 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..798 189..986 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:00 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..798 189..986 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:18 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..798 189..986 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:48:30 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..798 189..986 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:24:11 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..798 189..986 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:35 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..1053 1..1053 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:00 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..1053 1..1053 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:19 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..798 189..986 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:48:30 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4815-RA 1..1053 1..1053 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:34 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27989699..27990751 1..1053 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:34 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27989699..27990751 1..1053 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:34 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27989699..27990751 1..1053 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:00 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23815421..23816473 1..1053 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:46 Download gff for IP10137.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27730530..27731582 1..1053 100   Minus

IP10137.pep Sequence

Translation from 188 to 985

> IP10137.pep
MESGWTLVRLLLILNSVRTEAGNREEWTGRFHPRIYNGIKTTVESLGGVG
IQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHG
NNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVL
HPRDKLIAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPN
IICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNNEKPDVYMGVR
YYAKFIKRTINRMGF*

IP10137.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16132-PA 279 GF16132-PA 43..278 30..264 657 48.9 Plus
Dana\GF24381-PA 250 GF24381-PA 7..249 5..261 266 27.4 Plus
Dana\GF10196-PA 263 GF10196-PA 10..259 11..262 263 29.8 Plus
Dana\GF10197-PA 277 GF10197-PA 44..273 32..263 259 29.4 Plus
Dana\GF10198-PA 272 GF10198-PA 44..268 34..260 242 30.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12075-PA 183 GG12075-PA 2..183 84..265 747 74.7 Plus
Dere\GG13273-PA 292 GG13273-PA 61..288 34..263 289 31.5 Plus
Dere\GG23011-PA 246 GG23011-PA 17..246 29..262 265 29 Plus
Dere\GG13274-PA 273 GG13274-PA 43..267 34..260 258 30.1 Plus
Dere\GG14278-PA 248 GG14278-PA 1..246 1..260 253 26.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15252-PA 261 GH15252-PA 25..259 20..260 270 28.8 Plus
Dgri\GH15251-PA 253 GH15251-PA 21..251 34..263 221 26.5 Plus
Dgri\GH16940-PA 413 GH16940-PA 172..407 28..256 208 27.2 Plus
Dgri\GH15245-PA 343 GH15245-PA 119..341 32..260 200 27.1 Plus
Dgri\GH22870-PA 262 GH22870-PA 57..256 60..258 198 27.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4815-PA 265 CG4815-PA 1..265 1..265 1431 100 Plus
CG11037-PA 292 CG11037-PA 61..288 34..263 282 31.5 Plus
Sems-PA 275 CG10586-PA 40..270 31..263 262 29.4 Plus
CG10587-PA 276 CG10587-PA 42..269 31..260 258 30.9 Plus
CG3650-PA 249 CG3650-PA 19..249 28..262 253 27.4 Plus
CG32271-PA 248 CG32271-PA 1..246 1..260 252 27 Plus
CG10587-PC 289 CG10587-PC 42..282 31..260 250 29.7 Plus
CG34129-PA 314 CG34129-PA 39..264 34..259 237 26.4 Plus
CG11664-PA 254 CG11664-PA 18..241 30..260 236 27.8 Plus
CG32269-PB 332 CG32269-PB 88..318 14..249 217 27.5 Plus
CG32269-PA 332 CG32269-PA 88..318 14..249 217 27.5 Plus
CG32270-PA 259 CG32270-PA 56..257 61..262 204 28 Plus
CG4998-PA 891 CG4998-PA 672..885 61..258 204 28.3 Plus
CG4998-PB 1185 CG4998-PB 966..1179 61..258 204 28.3 Plus
CG4386-PA 372 CG4386-PA 126..355 34..257 202 28.6 Plus
CG13430-PB 267 CG13430-PB 47..266 49..263 200 29.2 Plus
CG13430-PA 267 CG13430-PA 47..266 49..263 200 29.2 Plus
CG8299-PA 260 CG8299-PA 55..253 60..257 198 26.8 Plus
CG11836-PI 281 CG11836-PI 44..274 34..260 196 29.5 Plus
CG11836-PJ 333 CG11836-PJ 96..326 34..260 196 29.5 Plus
CG9294-PB 352 CG9294-PB 100..334 34..256 193 26.4 Plus
CG11836-PF 223 CG11836-PF 9..216 58..260 190 30 Plus
CG11836-PE 223 CG11836-PE 9..216 58..260 190 30 Plus
CG11836-PG 223 CG11836-PG 9..216 58..260 190 30 Plus
CG11836-PC 223 CG11836-PC 9..216 58..260 190 30 Plus
CG11836-PA 223 CG11836-PA 9..216 58..260 190 30 Plus
CG11836-PB 223 CG11836-PB 9..216 58..260 190 30 Plus
CG33159-PA 257 CG33159-PA 8..256 5..264 187 25.3 Plus
CG18735-PA 364 CG18735-PA 82..311 34..256 186 29.3 Plus
CG18557-PA 343 CG18557-PA 111..325 62..261 183 25.2 Plus
CG17239-PB 248 CG17239-PB 23..244 34..263 181 28.6 Plus
CG17239-PA 248 CG17239-PA 23..244 34..263 181 28.6 Plus
CG33160-PA 258 CG33160-PA 29..256 30..262 181 24.7 Plus
betaTry-PB 253 CG18211-PB 1..242 7..249 177 27.2 Plus
betaTry-PA 253 CG18211-PA 1..242 7..249 177 27.2 Plus
alphaTry-PA 256 CG18444-PA 1..254 7..261 175 25.2 Plus
CG32376-PA 291 CG32376-PA 62..290 31..262 174 25.6 Plus
CG14780-PA 302 CG14780-PA 32..271 34..257 174 26.3 Plus
etaTry-PA 262 CG12386-PA 59..256 61..258 173 27.8 Plus
thetaTry-PA 262 CG12385-PA 34..255 34..256 172 26.3 Plus
CG31681-PA 264 CG31681-PA 54..255 61..262 172 28 Plus
CG34458-PA 257 CG34458-PA 47..256 49..261 171 27.9 Plus
CG3355-PA 314 CG3355-PA 92..304 52..258 171 25.8 Plus
CG11841-PA 319 CG11841-PA 96..311 55..257 170 26.7 Plus
CG17404-PB 275 CG17404-PB 60..269 56..256 166 27.2 Plus
CG32374-PA 299 CG32374-PA 73..298 34..262 164 27.7 Plus
CG6048-PA 362 CG6048-PA 45..292 34..264 164 26.7 Plus
epsilonTry-PA 256 CG18681-PA 30..252 34..259 163 22.9 Plus
CG10587-PD 225 CG10587-PD 42..196 31..189 161 30.6 Plus
gammaTry-PA 253 CG30028-PA 1..242 7..249 160 26 Plus
CG30025-PA 253 CG30025-PA 1..242 7..249 160 26 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24851-PA 260 GI24851-PA 30..256 33..263 527 40.9 Plus
Dmoj\GI11961-PA 263 GI11961-PA 38..263 34..262 277 31.2 Plus
Dmoj\GI11960-PA 250 GI11960-PA 20..250 34..263 246 28.2 Plus
Dmoj\GI18352-PA 287 GI18352-PA 32..279 1..256 246 30.3 Plus
Dmoj\GI16837-PA 287 GI16837-PA 53..286 34..264 234 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23874-PA 258 GL23874-PA 9..258 11..265 676 48.6 Plus
Dper\GL25243-PA 261 GL25243-PA 31..260 28..261 281 29.8 Plus
Dper\GL26259-PA 274 GL26259-PA 41..267 32..260 241 29.1 Plus
Dper\GL16806-PA 265 GL16806-PA 45..264 51..263 220 29.1 Plus
Dper\GL25242-PA 254 GL25242-PA 16..253 28..264 217 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18452-PA 258 GA18452-PA 9..258 11..265 676 48.6 Plus
Dpse\GA16803-PA 257 GA16803-PA 27..256 28..261 282 29.8 Plus
Dpse\GA10417-PA 274 GA10417-PA 41..267 32..260 242 29.1 Plus
Dpse\GA17587-PA 255 GA17587-PA 28..255 31..262 234 26.4 Plus
Dpse\GA17236-PA 265 GA17236-PA 45..264 51..263 220 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16301-PA 265 GM16301-PA 1..265 1..265 1267 89.1 Plus
Dsec\GM11905-PA 249 GM11905-PA 19..249 28..262 264 28.7 Plus
Dsec\GM22176-PA 278 GM22176-PA 40..270 31..263 263 27.7 Plus
Dsec\GM14071-PA 248 GM14071-PA 24..246 34..260 261 28.4 Plus
Dsec\GM22175-PA 276 GM22175-PA 42..269 31..260 257 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18039-PA 265 GD18039-PA 1..265 1..265 1262 89.1 Plus
Dsim\GD12154-PA 292 GD12154-PA 61..288 34..263 288 31 Plus
Dsim\GD11903-PA 249 GD11903-PA 19..249 28..262 265 28.7 Plus
Dsim\GD17559-PA 278 GD17559-PA 40..270 31..263 261 27.2 Plus
Dsim\GD12153-PA 276 GD12153-PA 42..272 31..263 256 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24493-PA 258 GJ24493-PA 30..257 34..264 552 41.6 Plus
Dvir\GJ24492-PA 257 GJ24492-PA 17..255 18..263 548 40.9 Plus
Dvir\GJ12185-PA 243 GJ12185-PA 42..241 59..260 273 32.2 Plus
Dvir\GJ12183-PA 250 GJ12183-PA 20..250 34..263 228 28.2 Plus
Dvir\GJ12587-PA 284 GJ12587-PA 48..281 34..265 227 28.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19112-PA 267 GK19112-PA 2..266 5..264 679 47.5 Plus
Dwil\GK19136-PA 252 GK19136-PA 28..251 34..261 281 29.7 Plus
Dwil\GK13475-PA 251 GK13475-PA 20..248 34..263 258 29.6 Plus
Dwil\GK21642-PA 254 GK21642-PA 26..254 30..262 258 28.1 Plus
Dwil\GK18835-PA 267 GK18835-PA 37..257 51..265 244 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10519-PA 318 GE10519-PA 124..318 71..265 807 71.8 Plus
Dyak\GE22369-PA 292 GE22369-PA 61..288 34..263 276 30.2 Plus
Dyak\GE22727-PA 292 GE22727-PA 61..288 34..263 276 30.2 Plus
Dyak\GE20706-PA 248 GE20706-PA 1..246 1..260 273 27.4 Plus
Dyak\GE22726-PA 276 GE22726-PA 42..269 31..260 272 31.9 Plus

IP10137.hyp Sequence

Translation from 188 to 985

> IP10137.hyp
MESGWTLVRLLLILNSVRTEAGNREEWTGRFHPRIYNGIKTTVESLGGVG
IQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHG
NNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVL
HPRDKLIAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPN
IICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNNEKPDVYMGVR
YYAKFIKRTINRMGF*

IP10137.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4815-PA 265 CG4815-PA 1..265 1..265 1431 100 Plus
CG11037-PA 292 CG11037-PA 61..288 34..263 282 31.5 Plus
Sems-PA 275 CG10586-PA 40..270 31..263 262 29.4 Plus
CG10587-PA 276 CG10587-PA 42..269 31..260 258 30.9 Plus
CG3650-PA 249 CG3650-PA 19..249 28..262 253 27.4 Plus