Clone IP10158 Report

Search the DGRC for IP10158

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:58
Vector:pOT2
Associated Gene/TranscriptCG7079-RA
Protein status:IP10158.pep: gold
Preliminary Size:768
Sequenced Size:938

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7079 2005-01-01 Successful iPCR screen
CG7079 2008-04-29 Release 5.5 accounting
CG7079 2008-08-15 Release 5.9 accounting
CG7079 2008-12-18 5.12 accounting

Clone Sequence Records

IP10158.complete Sequence

938 bp (938 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023318

> IP10158.complete
AGTAGTTGGCATCGGCTATGCTAGTGTATCGGTCTACTGAGTGCTTAAGC
GTTACTTGTGGAGTATTCGAGTTTATTTCGCTGTCAGATGCATTTCCTGG
CCTACGTGATTATAACAATTCAGCTGTTCGGTGGACTGCAGTGCCAGAAG
TTGCCTGCCAAGGTGAAAAAATGCCACTTCGGTGACGGAAAGTGCCTGGT
AGAGTCGGCAAATGCACTGCTGAGAGATTTTCCAAAGGGCATTCCCGAGG
TCGATCTGAAACCCTTCAATGTGCTGTCCGTGCGGGATTGGCTGCTGGTC
AACGATTCCCAGGTGGGAGGTGCCTGGTACTACTTCAATCTGATCAATCA
GATCAACTATGGCTTCGAGAACACCACGATCACGGAGATCAGGGGATTCG
ACAAGGATCCCACCACCACCAAGATCGAAATTCACGGCAAGATTCCCCGG
CTGGTTTACAAGGGCGACTATGTGGCCAAGGGACGGATGCTCTGGTTCGT
CGATATCCACTCTCAGGGAACGTCGGAGTCGGATTTCCTCAATTTTCAAT
TCGTTCTTACGCTGAAAGTGCGCGTCGAGTACAGAAACAACAAGAGATAT
TTAAAGATCTACGAGCTAGTTCCTAATATAAGGCTGGACCGCTGGATTAT
GTGGCTAGACAACTTCTTTCCCGACAATGAAGACCTAACGATTGCAGTTA
ACAATCTGTTCAACCGGAATTGGGTGGAGTTCTGGAACGAACTGGAGCCG
GGTATTCTGCGTTTGTTCGAAACCGTCTTTTTAAGTCTATTTGAGGATTT
ATTCGAAAAAGTACCCTATGATGATCTGTTCCTAGCCGCTGAAGACCCAA
AGTAATCTTAAGTTTCAGTACTGATGACTTAAACGTATTTGCTAGTAAAA
ATAAAGTAGGATATTCGTAAAAAAAAAAAAAAAAAAAA

IP10158.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG7079-RA 1371 CG7079-RA 211..1131 1..921 4605 100 Plus
CG31207-RA 1029 CG31207-RA 368..474 332..438 205 79.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16871973..16872459 641..155 2405 99.6 Minus
chr3R 27901430 chr3R 16871626..16871903 918..641 1375 99.6 Minus
chr3R 27901430 chr3R 16872520..16872673 154..1 740 98.7 Minus
chr3R 27901430 chr3R 16870364..16870502 470..332 230 77.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21048112..21048598 641..155 2435 100 Minus
3R 32079331 3R 21047762..21048042 921..641 1405 100 Minus
3R 32079331 3R 21048660..21048813 154..1 770 100 Minus
3R 32079331 3R 21046536..21046642 438..332 205 79.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20788943..20789429 641..155 2435 100 Minus
3R 31820162 3R 20788593..20788873 921..641 1405 100 Minus
3R 31820162 3R 20789491..20789644 154..1 770 100 Minus
3R 31820162 3R 20787367..20787473 438..332 205 79.4 Minus
Blast to na_te.dros performed on 2019-03-16 06:16:44 has no hits.

IP10158.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:17:24 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16871626..16871902 642..918 99 <- Minus
chr3R 16871973..16872459 155..641 99 <- Minus
chr3R 16872520..16872673 1..154 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:23 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 1..768 88..855 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:23 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 1..768 88..855 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:26 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 1..768 88..855 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:56:02 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 1..768 88..855 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:33 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 1..768 88..855 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:05:22 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 1..768 88..855 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:23 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 9..926 1..918 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:26 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 9..926 1..918 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:56:02 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 1..768 88..855 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:33 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
CG7079-RA 17..934 1..918 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:24 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21047765..21048041 642..918 100 <- Minus
3R 21048112..21048598 155..641 100 <- Minus
3R 21048660..21048813 1..154 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:24 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21047765..21048041 642..918 100 <- Minus
3R 21048112..21048598 155..641 100 <- Minus
3R 21048660..21048813 1..154 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:24 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21047765..21048041 642..918 100 <- Minus
3R 21048112..21048598 155..641 100 <- Minus
3R 21048660..21048813 1..154 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:26 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16873487..16873763 642..918 100 <- Minus
arm_3R 16873834..16874320 155..641 100 <- Minus
arm_3R 16874382..16874535 1..154 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:16 Download gff for IP10158.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20788596..20788872 642..918 100 <- Minus
3R 20788943..20789429 155..641 100 <- Minus
3R 20789491..20789644 1..154 100   Minus

IP10158.hyp Sequence

Translation from 87 to 854

> IP10158.hyp
MHFLAYVIITIQLFGGLQCQKLPAKVKKCHFGDGKCLVESANALLRDFPK
GIPEVDLKPFNVLSVRDWLLVNDSQVGGAWYYFNLINQINYGFENTTITE
IRGFDKDPTTTKIEIHGKIPRLVYKGDYVAKGRMLWFVDIHSQGTSESDF
LNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFFPDNEDL
TIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLFLA
AEDPK*

IP10158.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG7079-PB 255 CG7079-PB 1..255 1..255 1371 100 Plus
CG7079-PA 255 CG7079-PA 1..255 1..255 1371 100 Plus
CG31207-PA 258 CG31207-PA 7..248 7..249 824 59.3 Plus
CG31189-PB 258 CG31189-PB 23..253 22..253 597 47 Plus
CG11852-PA 250 CG11852-PA 23..248 23..249 291 29.6 Plus

IP10158.pep Sequence

Translation from 87 to 854

> IP10158.pep
MHFLAYVIITIQLFGGLQCQKLPAKVKKCHFGDGKCLVESANALLRDFPK
GIPEVDLKPFNVLSVRDWLLVNDSQVGGAWYYFNLINQINYGFENTTITE
IRGFDKDPTTTKIEIHGKIPRLVYKGDYVAKGRMLWFVDIHSQGTSESDF
LNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFFPDNEDL
TIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLFLA
AEDPK*

IP10158.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18524-PA 253 GF18524-PA 1..253 1..253 1078 77.9 Plus
Dana\GF18526-PA 258 GF18526-PA 12..248 12..249 755 56.7 Plus
Dana\GF18525-PA 258 GF18525-PA 1..251 1..252 746 53.6 Plus
Dana\GF11740-PA 251 GF11740-PA 21..248 21..249 403 38.4 Plus
Dana\GF17552-PA 250 GF17552-PA 9..248 11..249 285 27.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14970-PA 255 GG14970-PA 1..255 1..255 1284 94.1 Plus
Dere\GG14982-PA 258 GG14982-PA 7..251 7..252 800 58.1 Plus
Dere\GG14993-PA 263 GG14993-PA 10..258 4..253 560 42.8 Plus
Dere\GG11378-PA 250 GG11378-PA 23..248 23..249 292 29.6 Plus
Dere\GG14959-PA 213 GG14959-PA 7..211 21..248 216 25.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16804-PA 243 GH16804-PA 10..235 25..250 651 53.3 Plus
Dgri\GH23203-PA 234 GH23203-PA 1..226 26..252 551 45.4 Plus
Dgri\GH17380-PA 248 GH17380-PA 17..246 19..249 279 27.8 Plus
Dgri\GH12677-PA 257 GH12677-PA 8..255 3..248 187 25.1 Plus
Dgri\GH18842-PA 260 GH18842-PA 28..255 18..248 181 25.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7079-PB 255 CG7079-PB 1..255 1..255 1371 100 Plus
CG7079-PA 255 CG7079-PA 1..255 1..255 1371 100 Plus
CG31207-PA 258 CG31207-PA 7..248 7..249 824 59.3 Plus
CG31189-PB 258 CG31189-PB 23..253 22..253 597 47 Plus
CG11852-PA 250 CG11852-PA 23..248 23..249 291 29.6 Plus
CG17279-PD 245 CG17279-PD 18..243 21..248 267 27.9 Plus
CG11854-PB 250 CG11854-PB 24..249 23..249 196 24 Plus
to-PB 249 CG11853-PB 19..245 21..248 181 23.5 Plus
to-PA 249 CG11853-PA 19..245 21..248 181 23.5 Plus
CG14661-PB 246 CG14661-PB 23..244 22..248 180 26.5 Plus
CG14661-PA 246 CG14661-PA 23..244 22..248 180 26.5 Plus
CG14259-PA 289 CG14259-PA 43..264 23..243 174 26.8 Plus
CG13618-PA 252 CG13618-PA 26..252 20..250 172 24.9 Plus
CG2016-PD 249 CG2016-PD 8..244 8..246 166 24.3 Plus
CG2016-PB 249 CG2016-PB 8..244 8..246 166 24.3 Plus
CG10407-PB 259 CG10407-PB 30..256 18..247 164 24.8 Plus
CG10407-PA 259 CG10407-PA 30..256 18..247 164 24.8 Plus
CG2016-PE 254 CG2016-PE 8..249 8..246 153 23.8 Plus
CG10407-PC 263 CG10407-PC 30..260 18..247 152 24.1 Plus
CG2650-PA 260 CG2650-PA 30..257 23..248 151 21.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10307-PA 256 GI10307-PA 1..250 1..250 834 61.2 Plus
Dmoj\GI10308-PA 253 GI10308-PA 7..248 7..249 762 54.7 Plus
Dmoj\GI10309-PA 228 GI10309-PA 2..227 26..252 579 46.7 Plus
Dmoj\GI21090-PA 232 GI21090-PA 10..229 26..248 466 41.3 Plus
Dmoj\GI23924-PA 255 GI23924-PA 20..253 15..249 269 25.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:52:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12687-PA 256 GL12687-PA 1..254 1..253 1058 76 Plus
Dper\GL12688-PA 258 GL12688-PA 1..251 1..252 733 52.8 Plus
Dper\GL12689-PA 262 GL12689-PA 9..254 7..253 642 47.8 Plus
Dper\GL11987-PA 250 GL11987-PA 6..248 4..249 286 27 Plus
Dper\GL12686-PA 243 GL12686-PA 18..241 20..248 269 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20085-PA 256 GA20085-PA 1..254 1..253 1061 76.4 Plus
Dpse\GA16093-PA 258 GA16093-PA 1..251 1..252 741 53.2 Plus
Dpse\GA16076-PA 262 GA16076-PA 9..254 7..253 643 47.8 Plus
Dpse\GA11236-PA 250 GA11236-PA 6..248 4..249 286 27 Plus
Dpse\GA27589-PA 227 GA27589-PA 2..225 20..248 244 27.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15111-PA 255 GM15111-PA 1..255 1..255 1290 95.7 Plus
Dsec\GM15112-PA 258 GM15112-PA 7..248 7..249 802 58.8 Plus
Dsec\GM15113-PA 263 GM15113-PA 7..258 1..253 573 43.1 Plus
Dsec\GM17820-PA 250 GM17820-PA 23..248 23..249 292 29.2 Plus
Dsec\GM15110-PA 224 GM15110-PA 18..222 21..248 224 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20015-PA 255 GD20015-PA 1..255 1..255 1270 94.5 Plus
Dsim\GD20016-PA 258 GD20016-PA 7..248 7..249 802 58.8 Plus
Dsim\GD20018-PA 205 GD20018-PA 1..200 53..253 453 43.3 Plus
Dsim\GD21189-PA 250 GD21189-PA 23..248 23..249 297 29.6 Plus
Dsim\GD21191-PA 250 GD21191-PA 19..249 18..249 207 23.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10161-PA 258 GJ10161-PA 1..250 1..250 897 63.2 Plus
Dvir\GJ10162-PA 257 GJ10162-PA 1..248 1..249 761 52.6 Plus
Dvir\GJ10163-PA 256 GJ10163-PA 22..249 21..249 601 48.5 Plus
Dvir\GJ11684-PA 210 GJ11684-PA 11..206 53..249 539 50.3 Plus
Dvir\GJ20936-PA 327 GJ20936-PA 84..325 11..249 516 40.8 Plus
Dvir\GJ20936-PA 327 GJ20936-PA 4..99 133..228 213 43.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14312-PA 253 GK14312-PA 1..253 1..253 967 70 Plus
Dwil\GK14315-PA 258 GK14315-PA 10..251 10..252 736 53.5 Plus
Dwil\GK14313-PA 240 GK14313-PA 2..219 26..244 693 55.7 Plus
Dwil\GK14318-PA 261 GK14318-PA 22..253 21..253 600 46.4 Plus
Dwil\GK13450-PA 250 GK13450-PA 1..248 1..249 285 25.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25022-PA 254 GE25022-PA 1..253 1..253 1269 94.1 Plus
Dyak\GE25023-PA 258 GE25023-PA 1..248 1..249 808 58.6 Plus
Dyak\GE23575-PA 251 GE23575-PA 24..249 23..249 292 29.6 Plus
Dyak\GE25021-PA 245 GE25021-PA 4..243 7..248 251 25.5 Plus
Dyak\GE23577-PA 250 GE23577-PA 19..249 18..249 212 23.5 Plus