Clone IP10160 Report

Search the DGRC for IP10160

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:60
Vector:pOT2
Associated Gene/TranscriptCG7550-RA
Protein status:IP10160.pep: gold
Preliminary Size:921
Sequenced Size:919

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7550 2005-01-01 Successful iPCR screen
CG7550 2008-04-29 Release 5.5 accounting
CG7550 2008-08-15 Release 5.9 accounting
CG7550 2008-12-18 5.12 accounting

Clone Sequence Records

IP10160.complete Sequence

919 bp assembled on 2006-11-09

GenBank Submission: BT023322

> IP10160.complete
TTTTGCTTTTTACTGTATCCGACCGGAGTTCAGTACACCTGGCCGAAAAA
GATGACGACGCACTTCAGCAATGTACTGCGGCAGGCATTCAAAACGTTCG
ACCGGGCAAATCACGCCAGCTTCAATGCGAATTTGCAGCATCTGCGTCAA
TTGACGGATGAGCTGACCTACCGGGATCTGCACCTCCGCGAGGAGCTCTT
TCGCAACGTGGGAAGCCATCGGGCACCCTGCAGCTACATGCATATATTCG
AGGATGATCGCTTCTCCATGAGCCTGTTTATAGTGCGCGGAGCGAGCACT
ATTCCCTTGCACGATCACCCCATGATGTTCGGTCTGCTGCGCTGCATCTG
GGGTCAGCTAATGGTGGACAGCTTTTCGCACCAGTTAGGCCCGGATGAGC
CGCTCACCTATGACCCCCATCAAACAGTGGTGAAGGTGAATGTCGAGGAA
CCCAAATTGGTCACGCCGGCTAGTCCGTGTGCCACATTGACTCCTAGAAA
GAGAAATTACCACCAGATTGCCCAAATTGGTAGCGGCGTAGCCGCTTTCT
TCGACATTCTTAGTCCGCCATACGATGCGGATATGCCAACATATGGACCG
CGACAGTGTCGCTTCTATCGCGCCACGGCAGAGGGCAGCCAGGTGCAGCT
GCACTGCATCCCATCACCGGATACATACTATTGCGATGTTGTGGACACGC
CCGAATCGGTGATGCAGGCCGCTTTTCAGTGCGCCGACGAGGTCTATGCC
GATAATGCCAGCGGGACACAGTGAGTCGTTATCTCGCTTCCCAGCAGCTA
ACACCCTCCTATTTATTTGCCCATAATCAACCGTTGGCTGATCGTATCAG
CCAAGTATCTTCTGTGTTATTTAAATAAAATTGCCTCCTTTTTTTGTATA
AAAAAAAAAAAAAAAAAAA

IP10160.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7550-RA 921 CG7550-RA 22..921 1..900 4500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8115653..8116551 899..1 4495 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8123609..8124510 902..1 4510 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8116709..8117610 902..1 4510 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:08:37 has no hits.

IP10160.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:09:14 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8115653..8116551 1..899 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:24 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 1..723 52..774 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:32 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 1..723 52..774 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:48:53 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 1..723 52..774 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:35:32 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 1..723 52..774 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:29:48 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 1..723 52..774 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:47:54 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 22..920 1..899 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:32 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 22..920 1..899 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:53 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 22..920 1..899 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:35:33 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 22..920 1..899 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:48 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
CG7550-RA 22..920 1..899 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:14 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8123612..8124510 1..899 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:14 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8123612..8124510 1..899 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:14 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8123612..8124510 1..899 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:53 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8116712..8117610 1..899 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:52 Download gff for IP10160.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8116712..8117610 1..899 100   Minus

IP10160.hyp Sequence

Translation from 0 to 773

> IP10160.hyp
FCFLLYPTGVQYTWPKKMTTHFSNVLRQAFKTFDRANHASFNANLQHLRQ
LTDELTYRDLHLREELFRNVGSHRAPCSYMHIFEDDRFSMSLFIVRGAST
IPLHDHPMMFGLLRCIWGQLMVDSFSHQLGPDEPLTYDPHQTVVKVNVEE
PKLVTPASPCATLTPRKRNYHQIAQIGSGVAAFFDILSPPYDADMPTYGP
RQCRFYRATAEGSQVQLHCIPSPDTYYCDVVDTPESVMQAAFQCADEVYA
DNASGTQ*

IP10160.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG7550-PA 240 CG7550-PA 1..240 18..257 1296 100 Plus

IP10160.pep Sequence

Translation from 51 to 773

> IP10160.pep
MTTHFSNVLRQAFKTFDRANHASFNANLQHLRQLTDELTYRDLHLREELF
RNVGSHRAPCSYMHIFEDDRFSMSLFIVRGASTIPLHDHPMMFGLLRCIW
GQLMVDSFSHQLGPDEPLTYDPHQTVVKVNVEEPKLVTPASPCATLTPRK
RNYHQIAQIGSGVAAFFDILSPPYDADMPTYGPRQCRFYRATAEGSQVQL
HCIPSPDTYYCDVVDTPESVMQAAFQCADEVYADNASGTQ*

IP10160.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10483-PA 243 GF10483-PA 1..237 1..236 1039 79.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14921-PA 240 GG14921-PA 1..240 1..240 1190 90.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15289-PA 242 GH15289-PA 1..242 1..240 909 67.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7550-PA 240 CG7550-PA 1..240 1..240 1296 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11999-PA 242 GI11999-PA 1..242 1..240 909 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22483-PA 248 GL22483-PA 1..248 1..240 1005 74.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20432-PA 248 GA20432-PA 1..248 1..240 1004 75.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24972-PA 240 GM24972-PA 1..240 1..240 1262 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13021-PA 240 GD13021-PA 1..240 1..240 1262 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13270-PA 242 GJ13270-PA 1..242 1..240 947 71.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19978-PA 270 GK19978-PA 1..236 1..230 853 67.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20374-PA 240 GE20374-PA 1..240 1..240 1218 92.9 Plus