Clone IP10175 Report

Search the DGRC for IP10175

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:101
Well:75
Vector:pOT2
Associated Gene/TranscriptCG9722-RA
Protein status:IP10175.pep: gold
Preliminary Size:865
Sequenced Size:936

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9722 2005-01-01 Successful iPCR screen
CG9722 2008-04-29 Release 5.5 accounting
CG9722 2008-08-15 Release 5.9 accounting
CG9722 2008-12-18 5.12 accounting

Clone Sequence Records

IP10175.complete Sequence

936 bp (936 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023338

> IP10175.complete
ATTAAGAATTAGCAGTTACTTGAAAGTTGTGTTCGAAGGACACAATGCTG
GATATTTTACAAGAACCAGTACATCAGTATGGAAATCGGAGCCACCAGGC
GGAGTGTATTCCGCTGGGAAGATATACAGCTTACGGATCGGAAATCGGAC
AGGATGATCCAGACAAGGGCTTGGGATTCTGCAGCGCCAGCATCCGGCGA
GGATTCATCCGGAAGGTGTACCTCATCCTGTTGGCCCAACTGATCACTTC
CCTGGTGGTTATAGTTTCACTTACTGCTGATAAACGGGTGCGTCTGATGG
TGGCAGAAAGCACCTGGATATTTGTGGTGGCCATACTAATAGTGGTCTTC
TCTCTGGTGGCTCTGGGCTGCAATGAGGATCTGCGTCGTCAGACCCCAGC
TAACTTCATCTTCCTATCTGCCTTCACGATAGCCGAGTCCTTTCTGCTGG
GCGTGGCAGCCTGTCGTTATGCCCCAATGGAGATTTTCATGGCCGTGCTA
ATCACGGCGTCAGTTTGCCTTGGACTCACCCTTTTTGCTCTGCAGACGCG
TTACGACTTTACCGTCATGGGTGGCCTCCTGGTGAGCTGCCTGATAATAC
TGCTCTTCTTTGGAATTGTGACCATCTTCGTGGGCGGACATATGGTCACC
ACCATATATGCCTCATTGAGCGCTCTGCTCTTCTCCGTTTATTTAGTTTA
CGATACACAATTGATGATGGGAGGCAAGCATAGGTACTCCATTAGTCCCG
AGGAGTACATATTCGCTGCCCTAAATATTTACATGGATGTAATGAACATA
TTCCTGGACATTTTGCAATTAATCGGAGGATCCGATTAGTTGCATGAAAT
CTCACAAACACACAGATTATTTTACATCTGCAATTCGACGTCGAGTATTA
ATAAATCAAATTCAGCAGCAAAAAAAAAAAAAAAAA

IP10175.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9722-RA 945 CG9722-RA 27..945 1..919 4595 100 Plus
CG3814-RB 1142 CG3814-RB 755..909 657..811 295 79.3 Plus
CG3814-RA 1347 CG3814-RA 913..1067 657..811 295 79.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9977735..9978653 919..1 4595 100 Minus
chr2R 21145070 chr2R 8762603..8762757 811..657 295 79.4 Minus
chr2R 21145070 chr2R 8764984..8765121 812..675 240 78.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14152883..14153803 921..1 4605 100 Minus
2R 25286936 2R 12875304..12875458 811..657 295 79.4 Minus
2R 25286936 2R 12877685..12877822 812..675 240 78.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13893714..13894634 921..1 4605 100 Minus
2R 25260384 2R 12876503..12876657 811..657 295 79.3 Minus
2R 25260384 2R 12878884..12879021 812..675 240 78.2 Minus
Blast to na_te.dros performed on 2019-03-16 17:02:30 has no hits.

IP10175.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:03:18 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9977735..9978653 1..919 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:28 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 1..795 45..839 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:10:43 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 1..795 45..839 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:50 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 1..795 45..839 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:25 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 1..795 45..839 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:40 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 1..795 45..839 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:03:53 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 27..865 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:10:43 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 27..945 1..919 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:50 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 27..945 1..919 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:25 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 27..865 1..839 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:40 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
CG9722-RA 27..945 1..919 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:18 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14152885..14153803 1..919 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:18 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14152885..14153803 1..919 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:18 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14152885..14153803 1..919 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:50 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9978607..9979525 1..919 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:37 Download gff for IP10175.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13893716..13894634 1..919 100   Minus

IP10175.pep Sequence

Translation from 44 to 838

> IP10175.pep
MLDILQEPVHQYGNRSHQAECIPLGRYTAYGSEIGQDDPDKGLGFCSASI
RRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIV
VFSLVALGCNEDLRRQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMA
VLITASVCLGLTLFALQTRYDFTVMGGLLVSCLIILLFFGIVTIFVGGHM
VTTIYASLSALLFSVYLVYDTQLMMGGKHRYSISPEEYIFAALNIYMDVM
NIFLDILQLIGGSD*

IP10175.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18785-PA 255 GF18785-PA 2..254 12..264 882 65.2 Plus
Dana\GF11997-PA 323 GF11997-PA 86..321 25..263 687 54.1 Plus
Dana\GF11999-PA 247 GF11999-PA 9..245 30..263 664 54.9 Plus
Dana\GF13645-PA 255 GF13645-PA 23..251 32..260 332 34.5 Plus
Dana\GF15315-PA 226 GF15315-PA 25..224 66..264 244 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21447-PA 264 GG21447-PA 1..264 1..264 1216 86.4 Plus
Dere\GG22542-PA 324 GG22542-PA 93..322 37..263 707 57 Plus
Dere\GG22543-PA 244 GG22543-PA 7..242 31..263 613 54.2 Plus
Dere\GG23314-PA 274 GG23314-PA 44..270 34..260 290 31.3 Plus
Dere\GG24567-PA 221 GG24567-PA 41..220 83..264 180 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20515-PA 331 GH20515-PA 76..329 7..263 694 51.8 Plus
Dgri\GH19695-PA 263 GH19695-PA 28..255 30..257 647 53.1 Plus
Dgri\GH23740-PA 263 GH23740-PA 28..255 30..257 639 52.6 Plus
Dgri\GH20517-PA 246 GH20517-PA 19..242 38..261 602 54.5 Plus
Dgri\GH21302-PA 289 GH21302-PA 67..287 41..261 432 43.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9722-PA 264 CG9722-PA 1..264 1..264 1325 100 Plus
Nmda1-PH 313 CG3798-PH 76..311 25..263 709 55.8 Plus
Nmda1-PG 313 CG3798-PG 76..311 25..263 709 55.8 Plus
Nmda1-PA 313 CG3798-PA 76..311 25..263 709 55.8 Plus
Nmda1-PB 313 CG3798-PB 76..311 25..263 709 55.8 Plus
Nmda1-PI 316 CG3798-PI 79..314 25..263 709 55.8 Plus
Nmda1-PF 316 CG3798-PF 79..314 25..263 709 55.8 Plus
Nmda1-PE 324 CG3798-PE 87..322 25..263 709 55.8 Plus
Nmda1-PC 324 CG3798-PC 87..322 25..263 709 55.8 Plus
Nmda1-PD 324 CG3798-PD 87..322 25..263 709 55.8 Plus
Lfg-PD 239 CG3814-PD 12..235 38..261 653 54.9 Plus
Lfg-PA 239 CG3814-PA 12..235 38..261 653 54.9 Plus
Lfg-PB 244 CG3814-PB 17..240 38..261 653 54.9 Plus
Lfg-PC 203 CG3814-PC 1..199 63..261 575 53.8 Plus
CG30379-PB 295 CG30379-PB 56..291 25..260 354 32.2 Plus
CG33673-PB 235 CG33673-PB 22..231 51..261 274 31.6 Plus
CG34430-PA 264 CG34430-PA 41..232 50..249 189 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21061-PA 324 GI21061-PA 87..322 28..263 710 55.6 Plus
Dmoj\GI24550-PA 263 GI24550-PA 9..259 6..261 709 52.7 Plus
Dmoj\GI21062-PA 244 GI21062-PA 14..240 35..261 638 53.3 Plus
Dmoj\GI19790-PA 285 GI19790-PA 55..283 35..261 423 42.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23305-PA 282 GL23305-PA 6..252 11..257 747 59.7 Plus
Dper\GL17450-PA 319 GL17450-PA 82..317 25..263 704 55 Plus
Dper\GL17451-PA 245 GL17451-PA 1..241 24..261 619 52.3 Plus
Dper\GL11699-PA 304 GL11699-PA 76..300 30..260 382 35.1 Plus
Dper\GL18462-PA 223 GL18462-PA 22..211 64..253 257 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27217-PA 260 GA27217-PA 6..259 11..264 772 60.4 Plus
Dpse\GA17693-PC 308 GA17693-PC 71..306 25..263 704 55 Plus
Dpse\GA17693-PA 319 GA17693-PA 82..317 25..263 704 55 Plus
Dpse\GA17693-PB 310 GA17693-PB 73..308 25..263 703 55 Plus
Dpse\GA17704-PA 245 GA17704-PA 1..241 24..261 619 52.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25879-PA 264 GM25879-PA 1..264 1..264 1328 96.6 Plus
Dsec\GM20327-PA 324 GM20327-PA 87..322 25..263 717 55.8 Plus
Dsec\GM20328-PA 244 GM20328-PA 7..242 31..263 615 54.2 Plus
Dsec\GM20992-PA 243 GM20992-PA 24..239 14..260 281 30.2 Plus
Dsec\GM16580-PA 222 GM16580-PA 57..221 98..264 198 32.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20449-PA 262 GD20449-PA 1..262 1..264 1313 96.2 Plus
Dsim\GD25804-PA 324 GD25804-PA 87..322 25..263 715 55.8 Plus
Dsim\GD25805-PA 244 GD25805-PA 7..242 31..263 615 54.2 Plus
Dsim\GD10520-PA 275 GD10520-PA 24..271 14..260 318 31 Plus
Dsim\GD10521-PA 284 GD10521-PA 33..280 14..260 315 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22617-PA 262 GJ22617-PA 4..258 6..261 692 51.4 Plus
Dvir\GJ21985-PA 333 GJ21985-PA 97..331 29..263 683 55 Plus
Dvir\GJ21986-PA 244 GJ21986-PA 17..240 38..261 643 54.5 Plus
Dvir\GJ15114-PA 302 GJ15114-PA 73..299 35..259 431 43.2 Plus
Dvir\GJ22864-PA 199 GJ22864-PA 3..177 67..243 209 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19213-PA 271 GK19213-PA 21..271 21..264 750 58.2 Plus
Dwil\GK20878-PA 323 GK20878-PA 84..321 23..263 718 56.1 Plus
Dwil\GK20879-PA 244 GK20879-PA 17..240 38..261 654 54.9 Plus
Dwil\GK21973-PA 299 GK21973-PA 64..297 28..261 443 40.2 Plus
Dwil\GK20410-PA 176 GK20410-PA 23..173 88..238 187 35.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10054-PA 264 GE10054-PA 1..264 1..264 1244 89.8 Plus
Dyak\GE13412-PA 324 GE13412-PA 93..322 37..263 702 56.5 Plus
Dyak\GE13413-PA 244 GE13413-PA 7..242 31..263 613 54.2 Plus
Dyak\GE19159-PA 242 GE19159-PA 44..238 34..260 279 33 Plus
Dyak\GE15302-PA 223 GE15302-PA 23..223 65..264 218 31.4 Plus

IP10175.hyp Sequence

Translation from 44 to 838

> IP10175.hyp
MLDILQEPVHQYGNRSHQAECIPLGRYTAYGSEIGQDDPDKGLGFCSASI
RRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIV
VFSLVALGCNEDLRRQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMA
VLITASVCLGLTLFALQTRYDFTVMGGLLVSCLIILLFFGIVTIFVGGHM
VTTIYASLSALLFSVYLVYDTQLMMGGKHRYSISPEEYIFAALNIYMDVM
NIFLDILQLIGGSD*

IP10175.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9722-PA 264 CG9722-PA 1..264 1..264 1325 100 Plus
Nmda1-PH 313 CG3798-PH 76..311 25..263 709 55.8 Plus
Nmda1-PG 313 CG3798-PG 76..311 25..263 709 55.8 Plus
Nmda1-PA 313 CG3798-PA 76..311 25..263 709 55.8 Plus
Nmda1-PB 313 CG3798-PB 76..311 25..263 709 55.8 Plus