Clone IP10311 Report

Search the DGRC for IP10311

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:103
Well:11
Vector:pOT2
Associated Gene/Transcriptgdl-RA
Protein status:IP10311.pep2: gold IP10311.pep: gold
Preliminary Size:876
Sequenced Size:951

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33088 2005-01-01 Successful iPCR screen
gdl 2008-04-29 Release 5.5 accounting
gdl 2008-08-15 Release 5.9 accounting
gdl-ORF39 2008-08-15 Release 5.9 accounting
gdl 2008-12-18 5.12 accounting
gdl-ORF39 2008-12-18 5.12 accounting

Clone Sequence Records

IP10311.complete Sequence

951 bp (951 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023358.1

> IP10311.complete
CTCTGATACAACAAAAATATATATAAATACTTTTGAAACATTTTACTTTC
CGCGTCTTTCTCTGACTTACCGTTATGTGGGCAGCCAAACTGATTGTGGT
CACACTGCTGCTGCTGCAGTTTGCAGCCCTGGCGCTCAGCTGTTCGTGCG
GCGAAGAGGCGAAATTGGAGTGCGGTTGCACAAAACATCACTAAAAACAC
AAATACTTGGGAATATTACACAAATTATTGTAAATAAATAGGAAATCACA
ATTTAGTTAAGATGGCGGACATACCGGCAACCAGCGAAGGTAGTGCGAAC
ACTAGTGAGGCAGTAGTGGAGTATCAGCAGCCAACTCCGGAGTTTTTACA
ACGCAAAATCTATTTTTTGGTGGACCAATTGCGAACTTACCATTCGGAAC
TTCCCGAAAACTTGCAGACACGCATTTCCTACGATCTACTCACCGAACTC
GCCAATTGTGTGCTAAACGATGGCATTTTTGTAATAGTAAAAGCATTAAT
GGAGCTGCAACACGAAACCGAAAGACACTTGATTAAAATACGGATGCAGG
CGGAGAACGAGTATGAAATAGAAGTGGCCGAGTGGAGGAGCAAGATCAAG
GATCCCGAGGAGTTGCGCCACATTTTGGGACTCATGAAAATAAAGCACAC
TAAGAAACTACACGAGTCGGATACGAAGATTATCGAAATACTAGATCAAA
AGGTTAATGACCAACAATCCACACTTCAAAAGGCCGGCGTTCCCGGCTTC
TATGTCACCGAGAATCCAAAGGAGATAAAAATACAAATGTTCCTGTTGGA
CTTCATTTTGCGTTTGAGCCGGCTAAAATACGAGCCCGGCAAATAACAGT
TAGTCCACAATCCGGAGAACACAAAAGACTGCACTTGACTTGTTCAAATT
AGAATATTAAAGGCAATTAAATTATAACCCTGATCAAAAAAAAAAAAAAA
A

IP10311.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
gdl-RA 965 gdl-RA 31..965 1..935 4645 99.7 Plus
gdl-ORF39-RA 965 gdl-ORF39-RA 31..965 1..935 4645 99.7 Plus
Z600-RA 453 Z600-RA 415..453 1..39 195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15499427..15499833 1..407 1975 99 Plus
chr3L 24539361 chr3L 15499889..15500185 408..704 1485 100 Plus
chr3L 24539361 chr3L 15500552..15500786 701..935 1145 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15509475..15509881 1..407 2035 100 Plus
3L 28110227 3L 15509937..15510233 408..704 1470 99.7 Plus
3L 28110227 3L 15510603..15510840 701..938 1175 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15502575..15502981 1..407 2035 100 Plus
3L 28103327 3L 15503037..15503333 408..704 1470 99.6 Plus
3L 28103327 3L 15503703..15503940 701..938 1175 99.5 Plus
Blast to na_te.dros performed on 2019-03-15 16:57:54 has no hits.

IP10311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:58:59 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15499427..15499833 1..407 99 -> Plus
chr3L 15499889..15500183 408..702 100 -> Plus
chr3L 15500554..15500786 703..935 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:34 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-RA 1..585 262..846 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:10 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-RA 1..585 262..846 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:24:50 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-RA 1..585 262..846 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:51 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-RA 1..585 262..846 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:48 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-RA 1..585 262..846 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:04:59 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-ORF39-RA 31..876 1..846 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:10 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-RA 31..965 1..935 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:24:50 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-ORF39-RA 31..965 1..935 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:51 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-ORF39-RA 31..876 1..846 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:48 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
gdl-RA 31..965 1..935 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:59 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15510605..15510837 703..935 99   Plus
3L 15509475..15509881 1..407 100 -> Plus
3L 15509937..15510231 408..702 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:59 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15510605..15510837 703..935 99   Plus
3L 15509475..15509881 1..407 100 -> Plus
3L 15509937..15510231 408..702 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:59 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15510605..15510837 703..935 99   Plus
3L 15509475..15509881 1..407 100 -> Plus
3L 15509937..15510231 408..702 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:24:50 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15502575..15502981 1..407 100 -> Plus
arm_3L 15503037..15503331 408..702 99 -> Plus
arm_3L 15503705..15503937 703..935 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:04 Download gff for IP10311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15502575..15502981 1..407 100 -> Plus
3L 15503037..15503331 408..702 99 -> Plus
3L 15503705..15503937 703..935 99   Plus

IP10311.pep2 Sequence

Translation from 74 to 193

> IP10311.pep2
MWAAKLIVVTLLLLQFAALALSCSCGEEAKLECGCTKHH*

IP10311.pep2 Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
gdl-ORF39-PA 39 CG33755-PA 1..39 1..39 207 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23147-PA 39 GE23147-PA 1..39 1..39 165 84.6 Plus

IP10311.hyp Sequence

Translation from 261 to 845

> IP10311.hyp
MADIPATSEGSANTSEAVVEYQQPTPEFLQRKIYFLVDQLRTYHSELPEN
LQTRISYDLLTELANCVLNDGIFVIVKALMELQHETERHLIKIRMQAENE
YEIEVAEWRSKIKDPEELRHILGLMKIKHTKKLHESDTKIIEILDQKVND
QQSTLQKAGVPGFYVTENPKEIKIQMFLLDFILRLSRLKYEPGK*

IP10311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
gdl-PB 194 CG33756-PB 1..194 1..194 988 100 Plus
gdl-PC 194 CG33756-PC 1..194 1..194 988 100 Plus
gdl-PA 194 CG33756-PA 1..194 1..194 988 100 Plus

IP10311.pep Sequence

Translation from 261 to 845

> IP10311.pep
MADIPATSEGSANTSEAVVEYQQPTPEFLQRKIYFLVDQLRTYHSELPEN
LQTRISYDLLTELANCVLNDGIFVIVKALMELQHETERHLIKIRMQAENE
YEIEVAEWRSKIKDPEELRHILGLMKIKHTKKLHESDTKIIEILDQKVND
QQSTLQKAGVPGFYVTENPKEIKIQMFLLDFILRLSRLKYEPGK*

IP10311.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23703-PA 192 GF23703-PA 1..192 1..194 884 88.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15903-PA 194 GG15903-PA 1..194 1..194 959 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14543-PA 198 GH14543-PA 1..198 1..194 780 76.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
gdl-PB 194 CG33756-PB 1..194 1..194 988 100 Plus
gdl-PC 194 CG33756-PC 1..194 1..194 988 100 Plus
gdl-PA 194 CG33756-PA 1..194 1..194 988 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13114-PA 198 GI13114-PA 1..198 1..194 788 76.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24834-PA 198 GL24834-PA 1..198 1..194 884 85.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17270-PA 198 GA17270-PA 1..198 1..194 868 84.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25533-PA 194 GM25533-PA 1..194 1..194 987 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14548-PA 194 GD14548-PA 1..194 1..194 987 96.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13862-PA 196 GJ13862-PA 1..196 1..194 770 76.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15388-PA 190 GK15388-PA 22..190 26..194 687 75.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22244-PA 194 GE22244-PA 1..194 1..194 965 94.3 Plus
Dyak\GE23148-PA 194 GE23148-PA 1..194 1..194 961 93.8 Plus