Clone IP10340 Report

Search the DGRC for IP10340

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:103
Well:40
Vector:pOT2
Associated Gene/TranscriptCG5255-RA
Protein status:IP10340.pep: gold
Preliminary Size:822
Sequenced Size:915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5255 2005-01-01 Successful iPCR screen
CG5255 2008-04-29 Release 5.5 accounting
CG5255 2008-08-15 Release 5.9 accounting
CG5255 2008-12-18 5.12 accounting

Clone Sequence Records

IP10340.complete Sequence

915 bp (915 high quality bases) assembled on 2006-02-24

GenBank Submission: BT024991

> IP10340.complete
TTATGTTGCTCATTTTGTTACCACTTGTTCTGTTCACTTCGAGTGCCGCA
AGTCAGATCCTATATCCGCCGCAGTATACCAAGAATCGCATTGTGGGCGG
GGAGGAGGCTGCCGCAGGTCTGGCACCTTATCAGATATCCCTTCAAGGAA
TCGGCAGTGGAGCTCATTCCTGTGGCGGTGCTATCATCGATGAACGGTGG
ATTATAACGGCGGCTCACTGTACAAGAGGCAGACAGGCGACGGCATTTCG
GGTCCTAACAGGCACACAGGATCTGCATCAAAATGGATCCAAGTATTACT
ATCCCGACAGGATTGTGGAGCATAGTAACTATGCACCACGCAAGTATCGC
AACGATATAGCTTTACTGCATCTGAATGAATCGATTGTGTTTGATAATGC
CACTCAACCGGTGGAACTGGATCACGAGGCCTTGGTTCCAGGATCCCGAC
TCCTTTTAACCGGTTGGGGAACCCTCTCCTTGGGCGGAGATGTTCCCGCC
CGTCTGCAGAGTCTGGAGGTCAACTATGTGCCCTTCGAGCAGTGTCGAGC
TGCCCACGACAATAGCACTCGGGTGGACATTGGCCACGTTTGCACCTTCA
ATGACAAGGGACGCGGAGCGTGTCATGGAGATTCCGGTGGTCCTCTGGTG
CACAATGGCAAGCTGGTGGCTCTGGTCAACTGGGGACTGCCATGTGCTAA
AGGATATCCAGATGCTCACGCTTCAATTTCATATTATCACGACTTTATAC
GCACTCACCTAAGTCTATCCAAAACGGACAGCTCTGAGGATATCGAGGAG
GAAATGATTGCTCTCCAGGATTAGTGACAAGATAGACATTATAATAACAT
TATAAAAATCTTTCAAACTCTGAAAATATAAATGAAAGCTATAAAATGAA
AAAAAAAAAAAAAAA

IP10340.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG5255-RA 1089 CG5255-RA 138..1037 1..900 4500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12962333..12963043 1..711 3495 99.4 Plus
chr3R 27901430 chr3R 12963100..12963289 709..898 950 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17137909..17138619 1..711 3555 100 Plus
3R 32079331 3R 17138676..17138867 709..900 960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16878740..16879450 1..711 3555 100 Plus
3R 31820162 3R 16879507..16879698 709..900 960 100 Plus
3R 31820162 3R 16869710..16869783 621..694 175 82.4 Plus
Blast to na_te.dros performed on 2019-03-15 15:22:04 has no hits.

IP10340.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:23:04 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12962333..12963043 1..711 99 -> Plus
chr3R 12963103..12963289 712..898 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:36 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:16:05 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:25:56 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:31 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:53 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:44 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..898 1..898 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:16:05 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..898 1..898 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:25:56 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 17..914 1..898 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:32 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 1..898 1..898 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:53 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
CG5255-RA 17..914 1..898 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:04 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17137909..17138619 1..711 100 -> Plus
3R 17138679..17138865 712..898 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:04 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17137909..17138619 1..711 100 -> Plus
3R 17138679..17138865 712..898 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:04 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17137909..17138619 1..711 100 -> Plus
3R 17138679..17138865 712..898 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:25:56 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12963631..12964341 1..711 100 -> Plus
arm_3R 12964401..12964587 712..898 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:36:06 Download gff for IP10340.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16878740..16879450 1..711 100 -> Plus
3R 16879510..16879696 712..898 100   Plus

IP10340.pep Sequence

Translation from 2 to 823

> IP10340.pep
MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGI
GSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYY
PDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRL
LLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFN
DKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKGYPDAHASISYYHDFIR
THLSLSKTDSSEDIEEEMIALQD*

IP10340.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17133-PA 278 GF17133-PA 1..268 1..268 1244 84.3 Plus
Dana\GF17129-PA 274 GF17129-PA 33..257 25..251 611 50.7 Plus
Dana\GF17862-PA 288 GF17862-PA 48..273 27..254 564 50 Plus
Dana\GF19903-PA 267 GF19903-PA 28..260 21..254 562 45.5 Plus
Dana\GF17861-PA 252 GF17861-PA 16..248 24..257 546 45.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22071-PA 273 GG22071-PA 11..273 11..273 1361 95.1 Plus
Dere\GG22017-PA 273 GG22017-PA 33..260 25..254 617 52.6 Plus
Dere\GG22028-PA 266 GG22028-PA 36..259 29..254 546 46.5 Plus
Dere\GG16790-PA 288 GG16790-PA 47..272 27..254 546 47.4 Plus
Dere\GG16791-PA 267 GG16791-PA 23..252 26..254 525 46.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14067-PA 282 GH14067-PA 17..254 18..255 1056 81.1 Plus
Dgri\GH14062-PA 266 GH14062-PA 8..259 1..254 555 44.9 Plus
Dgri\GH14252-PA 282 GH14252-PA 43..273 28..260 547 46.4 Plus
Dgri\GH14066-PA 271 GH14066-PA 3..265 2..254 523 41 Plus
Dgri\GH14253-PA 260 GH14253-PA 22..247 30..254 514 46.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5255-PA 273 CG5255-PA 1..273 1..273 1447 100 Plus
CG31269-PB 273 CG31269-PB 5..260 1..254 607 50 Plus
CG17475-PB 288 CG17475-PB 47..272 27..254 562 47.4 Plus
CG17475-PA 288 CG17475-PA 47..272 27..254 562 47.4 Plus
CG31265-PA 266 CG31265-PA 8..259 2..254 547 44.9 Plus
CG17477-PA 267 CG17477-PA 27..252 30..254 533 47.4 Plus
CG4053-PB 265 CG4053-PB 33..257 28..252 531 47.6 Plus
CG5246-PA 272 CG5246-PA 39..261 27..249 498 42.9 Plus
CG31266-PB 282 CG31266-PB 49..277 27..254 469 41.3 Plus
CG31267-PA 275 CG31267-PA 43..265 28..249 451 41.1 Plus
CG16749-PA 265 CG16749-PA 29..258 29..250 379 37.1 Plus
CG12951-PA 265 CG12951-PA 28..264 28..256 349 35.1 Plus
Ser6-PA 259 CG2071-PA 14..256 5..252 340 32.6 Plus
CG31954-PA 277 CG31954-PA 50..274 29..252 338 35.8 Plus
CG32808-PA 284 CG32808-PA 29..255 29..249 330 35.8 Plus
gammaTry-PA 253 CG30028-PA 30..249 29..249 329 33.9 Plus
CG30025-PA 253 CG30025-PA 30..249 29..249 329 33.9 Plus
deltaTry-PA 253 CG12351-PA 30..249 29..249 329 33.9 Plus
CG30031-PA 253 CG30031-PA 30..249 29..249 329 33.9 Plus
betaTry-PB 253 CG18211-PB 30..249 29..249 329 34.4 Plus
betaTry-PA 253 CG18211-PA 30..249 29..249 329 34.4 Plus
CG8299-PA 260 CG8299-PA 9..252 2..249 327 32 Plus
CG1304-PA 260 CG1304-PA 25..256 23..252 323 30.3 Plus
alphaTry-PA 256 CG18444-PA 30..249 29..249 318 34.4 Plus
CG6041-PA 308 CG6041-PA 34..269 29..249 314 33.3 Plus
CG17571-PB 258 CG17571-PB 4..251 4..249 311 33.1 Plus
CG17571-PA 258 CG17571-PA 4..251 4..249 311 33.1 Plus
epsilonTry-PA 256 CG18681-PA 30..249 29..249 308 31.2 Plus
CG34458-PA 257 CG34458-PA 29..257 27..255 306 30 Plus
CG11192-PB 279 CG11192-PB 27..263 29..253 306 34.9 Plus
Sb-PB 787 CG4316-PB 541..786 27..253 302 32.1 Plus
Sb-PA 787 CG4316-PA 541..786 27..253 302 32.1 Plus
etaTry-PA 262 CG12386-PA 8..254 1..249 299 31.1 Plus
CG11912-PA 271 CG11912-PA 6..264 4..249 299 33.5 Plus
CG11836-PI 281 CG11836-PI 44..274 29..253 298 29.5 Plus
CG11836-PJ 333 CG11836-PJ 96..326 29..253 298 29.5 Plus
lambdaTry-PA 272 CG12350-PA 35..256 29..249 297 34.2 Plus
thetaTry-PA 262 CG12385-PA 4..237 2..232 296 31.8 Plus
CG8172-PD 371 CG8172-PD 120..362 25..249 296 32.1 Plus
CG8172-PE 545 CG8172-PE 294..536 25..249 296 32.1 Plus
CG8172-PF 561 CG8172-PF 310..552 25..249 296 32.1 Plus
zetaTry-PA 280 CG12387-PA 38..273 29..249 293 34.9 Plus
CG9676-PA 251 CG9676-PA 8..251 10..255 282 29.9 Plus
CG11836-PF 223 CG11836-PF 8..216 53..253 281 30 Plus
CG11836-PE 223 CG11836-PE 8..216 53..253 281 30 Plus
CG11836-PG 223 CG11836-PG 8..216 53..253 281 30 Plus
CG11836-PC 223 CG11836-PC 8..216 53..253 281 30 Plus
CG11836-PA 223 CG11836-PA 8..216 53..253 281 30 Plus
CG11836-PB 223 CG11836-PB 8..216 53..253 281 30 Plus
Ser8-PA 260 CG4812-PA 4..253 1..249 281 30 Plus
CG13430-PB 267 CG13430-PB 31..259 29..249 281 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24442-PA 279 GI24442-PA 20..257 18..255 1038 78.2 Plus
Dmoj\GI23142-PA 269 GI23142-PA 32..265 23..257 550 47.7 Plus
Dmoj\GI23145-PA 265 GI23145-PA 26..264 30..269 546 47.3 Plus
Dmoj\GI24438-PA 269 GI24438-PA 37..262 27..254 535 45.2 Plus
Dmoj\GI23144-PA 284 GI23144-PA 42..274 26..259 506 46 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27276-PA 239 GL27276-PA 4..233 2..272 948 67.9 Plus
Dper\GL27271-PA 271 GL27271-PA 31..258 25..254 606 51.1 Plus
Dper\GL27214-PA 286 GL27214-PA 44..270 27..254 580 50 Plus
Dper\GL27272-PA 264 GL27272-PA 1..257 2..254 553 42.1 Plus
Dper\GL27215-PA 268 GL27215-PA 28..254 30..254 532 48.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18766-PA 280 GA18766-PA 4..274 2..272 1241 83 Plus
Dpse\GA16138-PA 271 GA16138-PA 31..258 25..254 605 50.4 Plus
Dpse\GA14522-PA 286 GA14522-PA 44..270 27..254 580 50 Plus
Dpse\GA14523-PA 268 GA14523-PA 28..254 30..254 536 47.8 Plus
Dpse\GA17920-PA 266 GA17920-PA 30..255 24..250 520 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15215-PA 273 GM15215-PA 1..273 1..273 1428 97.8 Plus
Dsec\GM15383-PA 289 GM15383-PA 48..273 27..254 545 47.4 Plus
Dsec\GM15384-PA 267 GM15384-PA 27..252 30..254 529 46.9 Plus
Dsec\GM15382-PA 264 GM15382-PA 32..260 28..257 517 45.5 Plus
Dsec\GM15210-PA 266 GM15210-PA 30..259 23..254 516 44 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19145-PA 273 GD19145-PA 1..273 1..273 1437 97.8 Plus
Dsim\GD19140-PA 274 GD19140-PA 34..261 25..254 608 52.2 Plus
Dsim\GD20249-PA 288 GD20249-PA 47..272 27..254 559 48.2 Plus
Dsim\GD20250-PA 267 GD20250-PA 27..252 30..254 534 47.4 Plus
Dsim\GD19141-PA 266 GD19141-PA 30..259 23..254 525 44.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10718-PA 280 GJ10718-PA 21..258 18..255 1067 81.9 Plus
Dvir\GJ10446-PA 290 GJ10446-PA 49..270 27..250 542 49.6 Plus
Dvir\GJ10445-PA 269 GJ10445-PA 25..265 16..257 537 46.5 Plus
Dvir\GJ10713-PA 268 GJ10713-PA 36..261 27..254 526 44.7 Plus
Dvir\GJ10447-PA 268 GJ10447-PA 29..267 30..269 500 44 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12201-PA 260 GK12201-PA 5..253 19..268 1176 85.6 Plus
Dwil\GK12195-PA 272 GK12195-PA 35..259 28..254 592 50.2 Plus
Dwil\GK12196-PA 282 GK12196-PA 3..263 2..261 562 43.7 Plus
Dwil\GK10884-PA 290 GK10884-PA 46..268 26..249 557 48.2 Plus
Dwil\GK10883-PA 268 GK10883-PA 10..264 3..257 554 46.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10113-PA 277 GE10113-PA 1..273 1..273 1394 94.5 Plus
Dyak\GE24613-PA 274 GE24613-PA 38..261 29..254 598 53.1 Plus
Dyak\GE26105-PA 296 GE26105-PA 47..272 27..254 552 47.8 Plus
Dyak\GE26104-PA 264 GE26104-PA 32..260 28..257 526 45.9 Plus
Dyak\GE24614-PA 266 GE24614-PA 36..259 29..254 520 45.6 Plus

IP10340.hyp Sequence

Translation from 2 to 823

> IP10340.hyp
MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGI
GSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYY
PDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRL
LLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFN
DKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKGYPDAHASISYYHDFIR
THLSLSKTDSSEDIEEEMIALQD*

IP10340.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5255-PA 273 CG5255-PA 1..273 1..273 1447 100 Plus
CG31269-PB 273 CG31269-PB 5..260 1..254 607 50 Plus
CG17475-PB 288 CG17475-PB 47..272 27..254 562 47.4 Plus
CG17475-PA 288 CG17475-PA 47..272 27..254 562 47.4 Plus
CG31265-PA 266 CG31265-PA 8..259 2..254 547 44.9 Plus