Clone IP10341 Report

Search the DGRC for IP10341

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:103
Well:41
Vector:pOT2
Associated Gene/TranscriptCG5285-RA
Protein status:IP10341.pep: gold
Preliminary Size:843
Sequenced Size:962

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5285 2005-01-01 Successful iPCR screen
CG5285 2008-04-29 Release 5.5 accounting
CG5285 2008-08-15 Release 5.9 accounting
CG5285 2008-12-18 5.12 accounting

Clone Sequence Records

IP10341.complete Sequence

962 bp (962 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024334

> IP10341.complete
TCCTGTTCCGCTGAAGCAAACGTTATGCTGAAGCGCAAACTGAACCAGCA
AAAATGCAATCTGGAGATTGGGGAGCCCACTAAGACATCCGCAAGGCAGG
GCAGCACATCGGAATTCTTTGATAAGCCGCTGTGGCTTAAATTCTACGAA
ACCGAAGTCAAGTTAAATGAGGCGCTGGAAAAACTGAATCCTCCTGAGAG
CACACCGTTCATCTACAACCCGATAGTATATGCATCCCAGCTGCACTGCG
ACTATTTACGTCGCTATATGGACGGTCCCAAGAAGCTGGTATTTGTTGGC
ATGAATCCAGGGCCCAATGGAATGGCCCAAACCGGAATTCCCTTTGGCAA
TGTGCGCACAGTAAAGTTGTTAATGCAGCTGGCTGGTTCGGTGGACCAAC
CTCCAGTCGTGCATCCCAAACGTCCAGTCGCTGGCTTGGATTGTCGGATT
GAGGAGCCCAGTGGTGTGCGTTTGTGGGAGCTGTTCCTCCGACTGGCTGG
CAGCATGCAGACCTTCTCCCAGCAGTGTTTCGTCCACAATTTCTGTCCGC
TAGCTTTCTTTGGCGCAGATGGCAGGAACATAACGCCCAGTGAAATCAGA
GGAGCTTACAAAAATCAGCTAGGAGACCTGTGCCTGCACACCCTGGAGGA
ACAACTGAAGCTCCTCCAACCCGACGTGATTGTGGCCGTTGGGGAGTATG
TTCACAGCGCACTGAAGCGTTCAGGATATGCCAAATCCAATTGCGTTTCG
GTGCTCCGACTGCCGCATCCTAGTCCGCGTTCTACTAATAATACCAATTG
GCCCGAGAAGGCTCAAGCATTTTTGGAGGAGCACAACCTAATCCGATTCA
TGCGGAATGAGGCTTGAAGCAAAAATGGTCAATTATTTAGATAGTATTTA
CATATCTGTATCTGTACAAATACATTCTATGTATATATAAAAAAAAAAAA
AAAAAAAAAAAA

IP10341.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG5285-RA 1112 CG5285-RA 97..1036 1..940 4685 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12975441..12976042 337..938 2845 98.2 Plus
chr3R 27901430 chr3R 12975044..12975379 1..336 1635 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17151029..17151632 337..940 3020 100 Plus
3R 32079331 3R 17150632..17150967 1..336 1665 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16891860..16892463 337..940 3020 100 Plus
3R 31820162 3R 16891463..16891798 1..336 1665 99.7 Plus
Blast to na_te.dros performed on 2019-03-15 11:50:47 has no hits.

IP10341.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:51:36 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12975044..12975379 1..336 99 -> Plus
chr3R 12975441..12976042 337..938 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:37 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 1..843 25..867 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:05 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 1..843 25..867 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:33:40 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 1..843 25..867 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:11 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 1..843 25..867 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:44:06 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 1..843 25..867 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:32 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 1..843 25..867 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:05 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 46..983 1..938 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:33:40 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 46..983 1..938 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:11 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 1..843 25..867 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:44:06 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5285-RA 46..983 1..938 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:36 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17150632..17150967 1..336 99 -> Plus
3R 17151029..17151630 337..938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:36 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17150632..17150967 1..336 99 -> Plus
3R 17151029..17151630 337..938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:51:36 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17150632..17150967 1..336 99 -> Plus
3R 17151029..17151630 337..938 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:33:40 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12976354..12976689 1..336 99 -> Plus
arm_3R 12976751..12977352 337..938 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:39 Download gff for IP10341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16891463..16891798 1..336 99 -> Plus
3R 16891860..16892461 337..938 100   Plus

IP10341.hyp Sequence

Translation from 0 to 866

> IP10341.hyp
SCSAEANVMLKRKLNQQKCNLEIGEPTKTSARQGSTSEFFDKPLWLKFYE
TEVKLNEALEKLNPPESTPFIYNPIVYASQLHCDYLRRYMDGPKKLVFVG
MNPGPNGMAQTGIPFGNVRTVKLLMQLAGSVDQPPVVHPKRPVAGLDCRI
EEPSGVRLWELFLRLAGSMQTFSQQCFVHNFCPLAFFGADGRNITPSEIR
GAYKNQLGDLCLHTLEEQLKLLQPDVIVAVGEYVHSALKRSGYAKSNCVS
VLRLPHPSPRSTNNTNWPEKAQAFLEEHNLIRFMRNEA*

IP10341.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5285-PA 280 CG5285-PA 1..280 9..288 1493 100 Plus

IP10341.pep Sequence

Translation from 24 to 866

> IP10341.pep
MLKRKLNQQKCNLEIGEPTKTSARQGSTSEFFDKPLWLKFYETEVKLNEA
LEKLNPPESTPFIYNPIVYASQLHCDYLRRYMDGPKKLVFVGMNPGPNGM
AQTGIPFGNVRTVKLLMQLAGSVDQPPVVHPKRPVAGLDCRIEEPSGVRL
WELFLRLAGSMQTFSQQCFVHNFCPLAFFGADGRNITPSEIRGAYKNQLG
DLCLHTLEEQLKLLQPDVIVAVGEYVHSALKRSGYAKSNCVSVLRLPHPS
PRSTNNTNWPEKAQAFLEEHNLIRFMRNEA*

IP10341.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18138-PA 283 GF18138-PA 1..283 1..280 967 68 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22104-PA 280 GG22104-PA 1..280 1..280 1181 83.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13443-PA 280 GH13443-PA 1..280 1..280 931 60.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG5285-PA 280 CG5285-PA 1..280 1..280 1493 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24772-PA 284 GI24772-PA 1..267 1..279 749 52.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23677-PA 279 GL23677-PA 1..279 1..280 945 61.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18786-PA 279 GA18786-PA 1..279 1..280 956 61.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15218-PA 280 GM15218-PA 1..280 1..280 1367 91.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15165-PA 164 GD15165-PA 1..164 117..280 829 93.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24424-PA 284 GJ24424-PA 1..279 1..280 933 62.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11634-PA 285 GK11634-PA 1..284 1..280 941 62.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10117-PA 280 GE10117-PA 1..280 1..280 1273 85.7 Plus