Clone IP10364 Report

Search the DGRC for IP10364

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:103
Well:64
Vector:pOT2
Associated Gene/TranscriptRrp42-RA
Protein status:IP10364.pep: gold
Preliminary Size:915
Sequenced Size:1280

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8395 2005-01-01 Successful iPCR screen
Rrp42 2008-04-29 Release 5.5 accounting
Rrp42 2008-08-15 Release 5.9 accounting
Rrp42 2008-12-18 5.12 accounting

Clone Sequence Records

IP10364.complete Sequence

1280 bp (1280 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024331

> IP10364.complete
CGCAGACCGAAACAAAAGTGAAAACGTGCAAAAAACCAAACCCAAAAACA
AATTCAACCGAGAAGTAGAAGCAAGCGGCAAAGAAGAGAGCGAGAGGGCG
ACCAATACAAAAGCGACAAAATGTGCGACGCTGCGGCGGCAACAGCGACA
ACAACAACAACAGCAGCAGTAGCAGCAGCCGTCGCAACAACAACAGCATC
GGTAGCATTGGAGGCCACAGCGACACAGCCTGGAACGACAACGACGACGG
TAGCCACTGCGTCAGCGGGAACCACATCCCCTGAAGCGGCCATTCCAACA
GCAGCAACAGCAACATCGCCGACCGTTCGCTGTTTCTTGAATTAAGTCTA
AAATGGCATACGTTGCACTGAGCGAAGCTGAAAAAACATATATTCTACAC
GGCGTGGAGGATGACTTTCGTTGCGATGGACGTTCACGACGAGATTACCG
GCCCATGGACCTGGAAACTGGACTGGTTAGCAATGCCAGTGGATCCGCTC
GCCTTCGGCTGGCGAACACAGACATACTGGTGGGCGTCAAAACCGAGATT
GATGTACCCAACCCGCTGACGCCCGAGTTTGGTAAACTGGAATTTTTTGT
GGATTGCTCTGCTAATGCCACGCCGGAGTTTGAAGGACGCGGGGGCTCGG
ATCTGGCCCAAGAACTTATTCTCTCCCTGCAGAACGCCTACGAATCGCCA
TTGGCCTTCAACTACCGCACGTTGTGCCTCATTCCGGGTCAGCAGTGCTG
GAAGCTGTACATAGACATCCTGATTCTGGAGTGTGGCGGCAATCTACACG
ACGCAGTGTCGCTGGCCGCCAAAGCGGCTCTGTTCAACACAAAGCTGCCC
CGGGTGACAGCCACCATGTTGGATGCCGGCATCACAGACCTCATCATATC
GGACAATCCGTATGACTGCACCCGCATCGGCATCGAGACGGTTCCGCTGT
TGGTCACAGTTTGCAAGATCGGTGATTATGTCCTGGTGGATCCTTCGGCG
GAGGAGGAAGTCTGCAGCACAGTGAGCATGGTTGTGTCAGTTTCCATGCG
GAATGGACAGGCATTCCTTTCGGGTACACACTTGACCGGCGGCGGAGCCA
TGCACCGGGACACCATGCGCAACTGTCTGGAGCTGGGTCTGGCCATTGGC
GAGCATCTGGACCGGCTGCTCACTAAAATGCTAAATCTGGAGCAGCAGCG
CGTCGGACTCAAGCGACCGCAAATAGTAGGATTTCTTAAATAAAGCGGCA
AAGTCTTGTAATGAAAAAAAAAAAAAAAAA

IP10364.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp42-RA 1055 Rrp42-RA 87..1021 333..1267 4675 100 Plus
hang-RB 6919 hang-RB 376..697 1..322 1595 99.6 Plus
hang-RA 6966 hang-RA 376..697 1..322 1595 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11902828..11903319 772..1263 2460 100 Plus
chrX 22417052 chrX 16312882..16313203 1..322 1595 99.7 Plus
chr2R 21145070 chr2R 11902359..11902557 408..606 995 100 Plus
chr2R 21145070 chr2R 11902608..11902774 606..772 835 100 Plus
chr2R 21145070 chr2R 11902227..11902304 333..410 390 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16015559..16016054 772..1267 2480 100 Plus
X 23542271 X 16423160..16423481 1..322 1595 99.7 Plus
2R 25286936 2R 16015090..16015288 408..606 995 100 Plus
2R 25286936 2R 16015339..16015505 606..772 835 100 Plus
2R 25286936 2R 16014958..16015035 333..410 390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16016758..16017253 772..1267 2480 100 Plus
X 23527363 X 16431258..16431579 1..322 1595 99.6 Plus
2R 25260384 2R 16016289..16016487 408..606 995 100 Plus
2R 25260384 2R 16016538..16016704 606..772 835 100 Plus
2R 25260384 2R 16016157..16016234 333..410 390 100 Plus
Blast to na_te.dros performed 2019-03-16 03:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6898 149..325 291 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2514 140..323 288 63.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2671..2988 6..323 257 57.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6699..6923 90..314 254 59.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2380..2665 32..315 232 58.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2320..2646 11..323 175 54.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6863 184..317 172 61.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2598..2817 108..323 153 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6828 215..315 147 62.4 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 90..177 234..321 134 65.9 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9120..9207 234..321 134 65.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6776 263..317 131 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2397 239..323 130 63.5 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3192..3332 186..332 127 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6725..6818 218..317 126 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6797 257..317 125 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2148..2384 83..325 119 52.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2427 191..317 118 56.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2364 259..317 115 66.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2218..2343 193..317 113 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2309..2397 225..317 112 62.4 Plus

IP10364.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:44 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11902223..11902303 326..409 96 -> Plus
chr2R 11902361..11902557 410..606 100 -> Plus
chr2R 11902609..11902774 607..772 100 -> Plus
chr2R 11902829..11903319 773..1263 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:40 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..891 353..1243 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:31 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..891 353..1243 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:10 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..891 353..1243 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:41 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..891 353..1243 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:40 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..891 353..1243 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:56 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..911 353..1263 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:31 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..911 353..1263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:10 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 46..981 326..1263 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:42 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 1..911 353..1263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:40 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp42-RA 46..981 326..1263 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:44 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16014953..16015034 326..409 96 -> Plus
2R 16015092..16015288 410..606 100 -> Plus
2R 16015340..16015505 607..772 100 -> Plus
2R 16015560..16016050 773..1263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:44 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16014953..16015034 326..409 96 -> Plus
2R 16015092..16015288 410..606 100 -> Plus
2R 16015340..16015505 607..772 100 -> Plus
2R 16015560..16016050 773..1263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:44 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16014953..16015034 326..409 96 -> Plus
2R 16015092..16015288 410..606 100 -> Plus
2R 16015340..16015505 607..772 100 -> Plus
2R 16015560..16016050 773..1263 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:10 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11902458..11902539 326..409 96 -> Plus
arm_2R 11902597..11902793 410..606 100 -> Plus
arm_2R 11902845..11903010 607..772 100 -> Plus
arm_2R 11903065..11903555 773..1263 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:57 Download gff for IP10364.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16016152..16016233 326..409 96 -> Plus
2R 16016291..16016487 410..606 100 -> Plus
2R 16016539..16016704 607..772 100 -> Plus
2R 16016759..16017249 773..1263 100   Plus

IP10364.pep Sequence

Translation from 352 to 1242

> IP10364.pep
MAYVALSEAEKTYILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSAR
LRLANTDILVGVKTEIDVPNPLTPEFGKLEFFVDCSANATPEFEGRGGSD
LAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYIDILILECGGNLHD
AVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETVPLL
VTVCKIGDYVLVDPSAEEEVCSTVSMVVSVSMRNGQAFLSGTHLTGGGAM
HRDTMRNCLELGLAIGEHLDRLLTKMLNLEQQRVGLKRPQIVGFLK*

IP10364.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11284-PA 296 GF11284-PA 1..296 1..296 1365 88.2 Plus
Dana\GF22565-PA 412 GF22565-PA 13..293 7..295 178 25.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20559-PA 296 GG20559-PA 1..296 1..296 1522 96.6 Plus
Dere\GG18224-PA 415 GG18224-PA 13..281 7..283 155 23.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22060-PA 296 GH22060-PA 1..296 1..296 1359 88.5 Plus
Dgri\GH14641-PA 415 GH14641-PA 13..281 7..283 180 26.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp42-PA 296 CG8395-PA 1..296 1..296 1525 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19145-PA 296 GI19145-PA 1..296 1..296 1355 88.5 Plus
Dmoj\GI11625-PA 417 GI11625-PA 13..292 7..295 169 25.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10119-PA 296 GL10119-PA 1..296 1..296 1362 87.8 Plus
Dper\GL26867-PA 398 GL26867-PA 13..281 7..283 147 22.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21043-PA 296 GA21043-PA 1..296 1..296 1356 87.2 Plus
Dpse\GA21908-PA 398 GA21908-PA 13..288 7..288 148 22.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21652-PA 467 GM21652-PA 1..140 1..140 757 98.6 Plus
Dsec\GM13365-PA 405 GM13365-PA 13..280 7..282 148 23.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11151-PA 281 GD11151-PA 4..281 19..296 1456 98.6 Plus
Dsim\GD15722-PA 407 GD15722-PA 13..281 7..283 157 24.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22278-PA 296 GJ22278-PA 1..296 1..296 1344 87.8 Plus
Dvir\GJ11305-PA 423 GJ11305-PA 13..281 7..283 161 25.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21414-PA 296 GK21414-PA 1..296 1..296 1377 85.5 Plus
Dwil\GK14785-PA 415 GK14785-PA 13..294 7..295 184 26.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11745-PA 296 GE11745-PA 1..296 1..296 1518 96.3 Plus
Dyak\GE15642-PA 415 GE15642-PA 13..281 7..283 154 24 Plus

IP10364.hyp Sequence

Translation from 352 to 1242

> IP10364.hyp
MAYVALSEAEKTYILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSAR
LRLANTDILVGVKTEIDVPNPLTPEFGKLEFFVDCSANATPEFEGRGGSD
LAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYIDILILECGGNLHD
AVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETVPLL
VTVCKIGDYVLVDPSAEEEVCSTVSMVVSVSMRNGQAFLSGTHLTGGGAM
HRDTMRNCLELGLAIGEHLDRLLTKMLNLEQQRVGLKRPQIVGFLK*

IP10364.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp42-PA 296 CG8395-PA 1..296 1..296 1525 100 Plus