Clone IP10372 Report

Search the DGRC for IP10372

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:103
Well:72
Vector:pOT2
Associated Gene/TranscriptCG9459-RA
Protein status:IP10372.pep: gold
Preliminary Size:786
Sequenced Size:920

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9459 2005-01-01 Successful iPCR screen
CG9459 2008-04-29 Release 5.5 accounting
CG9459 2008-08-15 Release 5.9 accounting
CG9459 2008-12-18 5.12 accounting

Clone Sequence Records

IP10372.complete Sequence

920 bp (920 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023382

> IP10372.complete
CCGACGTCGATAACACTTAGATATCCGACATGTTTGCCCATATGCTGGAC
TTCCTGAATCGATCGCCACCGGATCCTGTGCGTCTTCCGTTGACCAGCAG
CCACTGGCCGGTGTTGACCATCCTTGGAATCTATCTAGTCTTCATAAAAA
TAGTGGGTCCTTGGTTTATGCAGAATCAAAAGCCCTACAATCTGGATAGA
GCTATCAAGATCTACAACATCGTGCAAATCGCATACAATGTCATTTTGTT
AATATTTAGTGTGCACTTCATGCTTGGTCCTGGCAACTATAACTTCAGTT
GCATATCCAATCTGCCGTTGGATCATGAGTACAAGAACTGGGAGCGTTGG
CTCAGTTACTCCTACTTCTTCAACAAGCTCATGGATCTGCTGGAGACTGT
GTTCTTTATATTCAGAAAGAAGTATCGCCAGATATCGTTCCTGCACGTTT
TCCACCACGTATACATGGTGTACATAGGCTTCTTGTACATGTATTATTAT
GGATACGGCGGCCATGGATTCTTCTTGATCACCTTCAACGTGGTGGTGCA
CACCATGATGTACACCTACTACTACCAGTCGTCCCTCAATCGGAACTCGG
GTGGCGATCTCTGGTGGAAGAAATACATCACAGTCGTTCAGCTTGTCCAA
TTTGTTATTATATTCTCGCACAGCGTCTATATCCTCCGGCAAACTGATTG
TCAAACATCACGATTATCGGCAACTTGGGGCTCACTGATATCTGTAGTAT
TTATAATTCTATTTAGTAACTTCTACGTTCGCACCTACATTCTTCCCAAG
AAAACGAAATCGGCGGTGGGCCGATGAGCAAAACTAATTAAGATTTAATA
TCACTGTTCCTTACATTAATCAATGTCATTAATAAATGCTTTTGATACAA
CAAAAAAAAAAAAAAAAAAA

IP10372.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG9459.a 1071 CG9459.a 168..1071 1..904 4520 100 Plus
CG9459-RA 1071 CG9459-RA 168..1071 1..904 4520 100 Plus
CG9458-RA 1046 CG9458-RA 340..781 213..654 845 79.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5643247..5643890 901..258 3220 100 Minus
chr3R 27901430 chr3R 5643959..5644215 257..1 1270 99.6 Minus
chr3R 27901430 chr3R 5644999..5645393 654..260 760 79.5 Minus
chr3R 27901430 chr3R 5639094..5639252 300..458 360 81.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9817425..9818071 904..258 3235 100 Minus
3R 32079331 3R 9818139..9818395 257..1 1285 100 Minus
3R 32079331 3R 9819179..9819573 654..260 790 80 Minus
3R 32079331 3R 9813275..9813433 300..458 360 81.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9558256..9558902 904..258 3235 100 Minus
3R 31820162 3R 9558970..9559226 257..1 1285 100 Minus
3R 31820162 3R 9560010..9560404 654..260 790 80 Minus
3R 31820162 3R 9554163..9554264 357..458 345 89.2 Plus
3R 31820162 3R 9555629..9555670 608..649 150 90.4 Plus
Blast to na_te.dros performed on 2019-03-16 15:09:42 has no hits.

IP10372.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:10:41 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5643247..5643890 258..901 100 <- Minus
chr3R 5643959..5644215 1..257 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:42 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..798 30..827 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:07 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..798 30..827 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:41:20 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..798 30..827 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:01:32 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..798 30..827 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:42 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..798 30..827 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:16:34 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..892 10..901 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:07 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..901 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:41:20 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..901 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:23 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..892 10..901 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:42 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
CG9459-RA 1..901 1..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:41 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9818139..9818395 1..257 100   Minus
3R 9817428..9818071 258..901 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:41 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9818139..9818395 1..257 100   Minus
3R 9817428..9818071 258..901 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:41 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9818139..9818395 1..257 100   Minus
3R 9817428..9818071 258..901 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:41:20 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5643150..5643793 258..901 100 <- Minus
arm_3R 5643861..5644117 1..257 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:13 Download gff for IP10372.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9558259..9558902 258..901 100 <- Minus
3R 9558970..9559226 1..257 100   Minus

IP10372.pep Sequence

Translation from 29 to 826

> IP10372.pep
MFAHMLDFLNRSPPDPVRLPLTSSHWPVLTILGIYLVFIKIVGPWFMQNQ
KPYNLDRAIKIYNIVQIAYNVILLIFSVHFMLGPGNYNFSCISNLPLDHE
YKNWERWLSYSYFFNKLMDLLETVFFIFRKKYRQISFLHVFHHVYMVYIG
FLYMYYYGYGGHGFFLITFNVVVHTMMYTYYYQSSLNRNSGGDLWWKKYI
TVVQLVQFVIIFSHSVYILRQTDCQTSRLSATWGSLISVVFIILFSNFYV
RTYILPKKTKSAVGR*

IP10372.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17148-PA 263 GF17148-PA 1..259 1..261 794 60.9 Plus
Dana\GF15498-PA 253 GF15498-PA 3..251 12..260 615 45.8 Plus
Dana\GF15497-PA 253 GF15497-PA 3..251 12..258 604 47.4 Plus
Dana\GF13996-PA 269 GF13996-PA 2..253 9..259 565 44.8 Plus
Dana\GF13758-PA 261 GF13758-PA 1..258 5..261 555 43 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17319-PA 264 GG17319-PA 1..263 1..263 1178 90.5 Plus
Dere\GG17318-PA 264 GG17318-PA 1..263 1..263 904 67.3 Plus
Dere\GG17214-PA 265 GG17214-PA 1..259 5..261 671 51.9 Plus
Dere\GG17320-PA 260 GG17320-PA 1..260 5..264 598 44.2 Plus
Dere\GG11234-PA 253 GG11234-PA 1..253 5..261 571 42.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19804-PA 261 GH19804-PA 1..251 5..254 554 43 Plus
Dgri\GH22831-PA 416 GH22831-PA 186..413 35..262 489 41.7 Plus
Dgri\GH19803-PA 217 GH19803-PA 1..216 47..261 432 41.2 Plus
Dgri\GH22831-PA 416 GH22831-PA 6..181 9..185 416 45.2 Plus
Dgri\GH17398-PA 285 GH17398-PA 32..262 21..253 378 38.4 Plus
Dgri\GH19244-PA 298 GH19244-PA 16..256 8..253 366 37.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9459-PA 265 CG9459-PA 1..265 1..265 1431 100 Plus
CG9458-PA 264 CG9458-PA 1..260 1..260 1025 69.6 Plus
CG8534-PA 265 CG8534-PA 1..262 5..263 709 53.2 Plus
eloF-PA 257 CG16905-PA 3..252 12..262 617 48 Plus
CG16904-PA 262 CG16904-PA 1..257 5..261 608 43.2 Plus
CG31141-PA 253 CG31141-PA 1..249 5..257 581 43.1 Plus
CG18609-PA 263 CG18609-PA 1..257 5..260 540 40.5 Plus
CG17821-PA 262 CG17821-PA 5..258 5..257 482 38.6 Plus
CG6660-PA 272 CG6660-PA 13..265 8..262 414 36.2 Plus
CG5326-PA 277 CG5326-PA 32..262 21..253 411 37.7 Plus
sit-PA 295 CG5278-PA 29..262 21..262 389 37.7 Plus
CG31522-PH 364 CG31522-PH 27..257 20..253 377 33.5 Plus
CG31522-PG 364 CG31522-PG 27..257 20..253 377 33.5 Plus
CG31522-PA 364 CG31522-PA 27..257 20..253 377 33.5 Plus
CG31522-PF 365 CG31522-PF 27..258 20..253 374 34.3 Plus
CG31522-PB 365 CG31522-PB 27..258 20..253 374 34.3 Plus
CG31522-PD 365 CG31522-PD 27..258 20..253 374 34.3 Plus
CG2781-PA 329 CG2781-PA 17..259 10..254 373 33.6 Plus
bond-PC 322 CG6921-PC 28..265 21..264 367 34.3 Plus
bond-PA 322 CG6921-PA 28..265 21..264 367 34.3 Plus
bond-PB 322 CG6921-PB 28..265 21..264 367 34.3 Plus
CG33110-PA 337 CG33110-PA 55..298 14..262 362 33.6 Plus
CG31522-PI 392 CG31522-PI 27..285 20..253 357 31.8 Plus
CG31523-PF 354 CG31523-PF 18..259 10..254 332 32.9 Plus
CG31523-PE 354 CG31523-PE 18..259 10..254 332 32.9 Plus
CG31523-PG 354 CG31523-PG 18..259 10..254 332 32.9 Plus
CG31523-PD 354 CG31523-PD 18..259 10..254 332 32.9 Plus
CG31523-PA 354 CG31523-PA 18..259 10..254 332 32.9 Plus
CG31523-PB 354 CG31523-PB 18..259 10..254 332 32.9 Plus
CG31523-PC 354 CG31523-PC 18..259 10..254 332 32.9 Plus
Elo68beta-PB 269 CG11801-PB 30..268 20..262 302 30.4 Plus
CG30008-PA 266 CG30008-PA 23..257 26..261 285 30.3 Plus
Elo68alpha-PA 262 CG32072-PA 23..259 20..265 279 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10225-PA 258 GI10225-PA 1..257 5..261 600 42.4 Plus
Dmoj\GI10223-PA 260 GI10223-PA 1..255 5..260 549 41 Plus
Dmoj\GI20345-PA 249 GI20345-PA 6..248 20..261 521 45.3 Plus
Dmoj\GI20347-PA 245 GI20347-PA 1..245 20..263 517 40.8 Plus
Dmoj\GI20344-PA 262 GI20344-PA 11..261 12..261 490 40.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23222-PA 264 GL23222-PA 1..259 5..261 712 54.4 Plus
Dper\GL23223-PA 262 GL23223-PA 1..257 5..261 642 47.1 Plus
Dper\GL11311-PA 284 GL11311-PA 12..260 15..262 483 38.2 Plus
Dper\GL11310-PA 263 GL11310-PA 6..262 5..260 454 40.1 Plus
Dper\GL13683-PA 277 GL13683-PA 32..271 21..265 380 36.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21802-PA 264 GA21802-PA 1..259 5..261 716 54.8 Plus
Dpse\GA14209-PA 262 GA14209-PA 1..257 5..261 628 45.9 Plus
Dpse\GA15013-PA 286 GA15013-PA 12..260 15..262 483 38.2 Plus
Dpse\GA14683-PA 263 GA14683-PA 6..262 5..260 458 40.1 Plus
Dpse\GA18806-PA 277 GA18806-PA 32..271 21..265 380 36.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26205-PA 270 GM26205-PA 1..264 1..264 1215 91.3 Plus
Dsec\GM26204-PA 218 GM26204-PA 1..190 1..190 677 71.1 Plus
Dsec\GM23845-PA 265 GM23845-PA 1..262 5..263 675 51.3 Plus
Dsec\GM23846-PA 258 GM23846-PA 3..252 12..261 617 47.8 Plus
Dsec\GM26206-PA 262 GM26206-PA 1..257 5..261 578 42.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20752-PA 265 GD20752-PA 1..265 1..265 1218 91.3 Plus
Dsim\GD20751-PA 264 GD20751-PA 1..262 1..262 998 68.7 Plus
Dsim\GD18652-PA 265 GD18652-PA 1..262 5..263 672 51 Plus
Dsim\GD18654-PA 263 GD18654-PA 3..254 12..261 611 47.8 Plus
Dsim\GD20753-PA 262 GD20753-PA 1..257 5..261 578 42.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11026-PA 263 GJ11026-PA 1..256 5..260 647 46.1 Plus
Dvir\GJ11028-PA 261 GJ11028-PA 1..257 5..261 562 41.2 Plus
Dvir\GJ11027-PA 244 GJ11027-PA 1..231 5..256 498 40.9 Plus
Dvir\GJ22069-PA 248 GJ22069-PA 1..237 19..254 495 41.4 Plus
Dvir\GJ22068-PA 217 GJ22068-PA 1..216 47..261 462 42.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20708-PA 255 GK20708-PA 1..253 5..257 557 42.7 Plus
Dwil\GK20709-PA 266 GK20709-PA 6..241 27..262 517 44.1 Plus
Dwil\GK20710-PA 205 GK20710-PA 1..205 5..209 460 42.9 Plus
Dwil\GK20706-PA 215 GK20706-PA 1..211 47..257 452 45 Plus
Dwil\GK11596-PA 221 GK11596-PA 1..211 47..257 420 42.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24723-PA 264 GE24723-PA 1..260 1..260 1184 92.7 Plus
Dyak\GE24722-PA 264 GE24722-PA 1..263 1..263 944 68.8 Plus
Dyak\GE25995-PA 254 GE25995-PA 3..252 12..261 641 48 Plus
Dyak\GE25994-PA 264 GE25994-PA 1..261 5..263 619 52.3 Plus
Dyak\GE24724-PA 262 GE24724-PA 1..257 5..261 613 45.1 Plus

IP10372.hyp Sequence

Translation from 29 to 826

> IP10372.hyp
MFAHMLDFLNRSPPDPVRLPLTSSHWPVLTILGIYLVFIKIVGPWFMQNQ
KPYNLDRAIKIYNIVQIAYNVILLIFSVHFMLGPGNYNFSCISNLPLDHE
YKNWERWLSYSYFFNKLMDLLETVFFIFRKKYRQISFLHVFHHVYMVYIG
FLYMYYYGYGGHGFFLITFNVVVHTMMYTYYYQSSLNRNSGGDLWWKKYI
TVVQLVQFVIIFSHSVYILRQTDCQTSRLSATWGSLISVVFIILFSNFYV
RTYILPKKTKSAVGR*

IP10372.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG9459-PA 265 CG9459-PA 1..265 1..265 1431 100 Plus
CG9458-PA 264 CG9458-PA 1..260 1..260 1025 69.6 Plus
CG8534-PA 265 CG8534-PA 1..262 5..263 709 53.2 Plus
eloF-PA 257 CG16905-PA 3..252 12..262 617 48 Plus
CG16904-PA 262 CG16904-PA 1..257 5..261 608 43.2 Plus