Clone IP10378 Report

Search the DGRC for IP10378

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:103
Well:78
Vector:pOT2
Associated Gene/Transcriptlectin-37Da-RA
Protein status:IP10378.pep:
Preliminary Size:893
Sequenced Size:666

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9978 2005-01-01 Successful iPCR screen
lectin-37Da 2008-04-29 Release 5.5 accounting
lectin-37Da 2008-08-15 Release 5.9 accounting
lectin-37Da 2008-12-18 5.12 accounting

Clone Sequence Records

IP10378.complete Sequence

666 bp (666 high quality bases) assembled on 2005-03-06

GenBank Submission: BT023386

> IP10378.complete
AAGACATTGGTTCAACTTTTCCTTGTTGTCGCCGGTTTTGCACCAGGATT
CGGCTACGACAAGTACACCACACACATACAAAATGGAAACCCGTACAACT
TGACCGTTGACATGACTCCCTTCATTAAGATCAACGAAAGCTACTATGTT
TTTGGACAGACTAAGGTCAATTGGTATGTCGCCTACGAGAACTGCCGCAG
GCTTCAATCCGAACTGGTGACCTTCGAAACAGCCGAAGAGTTTGACGCCA
TTGCCGCGTTCTTGAATGCCCGAGGAGATCGCTCCGAGCACTGGACCTCC
GGCAATGATTTGGGCAAAACCGGCACCCACTACTGGTTCTCTAATGCACA
ACTCGTGACCATTAAGCGTTGGGCGCCCAAACAACCAGACAATGCTGGCG
GTAGGGAGCATTGCATACACTTGGGCTACATCTACGGCTATTCAACGGAG
TTCCAACTGAATGATCGACCCTGCCACAACCACGCGAGTAGCTTGTTTAA
GTACATTTGTGAGGCTCCAAAGCAGGAAACTGTATCTATTGTTGTTTGGA
AGTAGAGTATGTGTCAATATATATATATTTATTGCTCTACTATGTCACAT
ATTGTCAGTGCTATAAAAGTCTTAAACTATCAGTCAACAACGCTAAAAAA
AAAAAAAAAAAAAAAA

IP10378.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Da-RB 652 lectin-37Da-RB 8..652 1..645 3225 100 Plus
lectin-37Da-RA 651 lectin-37Da-RA 8..651 1..644 3220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19417006..19417565 85..644 2800 100 Plus
chr2L 23010047 chr2L 19416860..19416945 1..86 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
CR31541-RA 430 CR31541-RA 123..164 207..248 165 92.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19418470..19419030 85..645 2805 100 Plus
2L 23513712 2L 19418324..19418409 1..86 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19418470..19419030 85..645 2805 100 Plus
2L 23513712 2L 19418324..19418409 1..86 430 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:28:46 has no hits.

IP10378.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:29:52 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19416860..19416944 1..85 100 -> Plus
chr2L 19417007..19417565 86..644 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:43 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 7..561 1..555 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:16 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RB 7..561 1..555 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:43 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 7..561 1..555 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:12 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 7..561 1..555 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:34 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 7..561 1..555 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:38 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:57:13 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 12..566 1..555 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:16 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 8..651 1..644 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:43 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 8..651 1..644 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:12 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 12..566 1..555 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:34 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Da-RA 8..651 1..644 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:52 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19418324..19418408 1..85 100 -> Plus
2L 19418471..19419029 86..644 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:52 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19418324..19418408 1..85 100 -> Plus
2L 19418471..19419029 86..644 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:52 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19418324..19418408 1..85 100 -> Plus
2L 19418471..19419029 86..644 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:43 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19418324..19418408 1..85 100 -> Plus
arm_2L 19418471..19419029 86..644 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:06 Download gff for IP10378.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19418471..19419029 86..644 100   Plus
2L 19418324..19418408 1..85 100 -> Plus

IP10378.pep Sequence

Translation from 0 to 554

> IP10378.pep
KTLVQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYV
FGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTS
GNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTE
FQLNDRPCHNHASSLFKYICEAPKQETVSIVVWK*

IP10378.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14041-PA 265 GF14041-PA 110..265 29..184 603 66 Plus
Dana\GF14718-PA 186 GF14718-PA 3..186 1..184 571 56.5 Plus
Dana\GF22005-PA 278 GF22005-PA 138..278 36..183 283 40.3 Plus
Dana\GF21734-PA 194 GF21734-PA 9..186 1..177 267 35.4 Plus
Dana\GF14041-PA 265 GF14041-PA 3..110 1..105 243 40.7 Plus
Dana\GF22005-PA 278 GF22005-PA 21..135 23..137 216 38.8 Plus
Dana\GF21983-PA 128 GF21983-PA 18..125 36..142 197 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21175-PA 186 GG21175-PA 3..186 1..184 858 84.8 Plus
Dere\GG21174-PA 186 GG21174-PA 18..186 16..184 560 58 Plus
Dere\GG19039-PA 188 GG19039-PA 3..188 1..183 260 32.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24460-PA 195 GH24460-PA 11..195 3..183 273 33.7 Plus
Dgri\GH19636-PA 174 GH19636-PA 36..160 41..165 217 37.8 Plus
Dgri\GH13620-PA 176 GH13620-PA 41..165 41..167 169 30.2 Plus
Dgri\GH10464-PA 197 GH10464-PA 72..194 40..172 157 31.3 Plus
Dgri\GH19780-PA 186 GH19780-PA 51..150 56..159 148 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Da-PB 186 CG33532-PB 3..186 1..184 1013 100 Plus
lectin-37Da-PA 186 CG33532-PA 3..186 1..184 1013 100 Plus
Lectin-galC1-PB 186 CG9976-PB 3..186 1..184 583 57.1 Plus
Lectin-galC1-PA 186 CG9976-PA 3..186 1..184 583 57.1 Plus
CG12111-PB 188 CG12111-PB 28..180 19..177 272 36 Plus
CG12111-PA 188 CG12111-PA 28..180 19..177 272 36 Plus
CG43055-PA 180 CG43055-PA 6..180 2..183 267 34.4 Plus
Sfp24F-PA 175 CG42468-PA 38..165 41..171 250 37.9 Plus
Sfp24F-PB 175 CG42468-PB 38..165 41..171 250 37.9 Plus
lectin-37Db-PB 150 CG33533-PB 24..148 29..171 177 29.4 Plus
lectin-37Db-PA 150 CG33533-PA 24..148 29..171 177 29.4 Plus
tfc-PC 188 CG9134-PC 53..175 40..158 150 30.4 Plus
tfc-PA 188 CG9134-PA 53..175 40..158 150 30.4 Plus
tfc-PB 376 CG9134-PB 241..363 40..158 150 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14863-PA 171 GI14863-PA 20..171 29..183 314 37.8 Plus
Dmoj\GI14792-PA 194 GI14792-PA 11..194 3..183 273 33.8 Plus
Dmoj\GI13595-PA 110 GI13595-PA 1..110 68..183 216 38.8 Plus
Dmoj\GI24801-PA 174 GI24801-PA 41..161 41..165 174 32 Plus
Dmoj\GI24628-PA 146 GI24628-PA 27..143 42..172 162 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21206-PA 186 GL21206-PA 3..186 1..184 585 57.6 Plus
Dper\GL26241-PA 180 GL26241-PA 15..180 13..183 308 37.6 Plus
Dper\GL19105-PA 171 GL19105-PA 19..171 29..183 285 39.9 Plus
Dper\GL14647-PA 194 GL14647-PA 12..186 4..177 258 32.8 Plus
Dper\GL26845-PA 183 GL26845-PA 54..176 41..171 141 31.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22161-PA 186 GA22161-PA 3..186 1..184 585 57.6 Plus
Dpse\GA28093-PA 180 GA28093-PA 15..180 13..183 316 39.1 Plus
Dpse\GA11405-PA 194 GA11405-PA 12..186 4..177 260 33.3 Plus
Dpse\GA30137-PA 162 GA30137-PA 31..161 45..178 178 32.4 Plus
Dpse\GA29074-PA 165 GA29074-PA 28..158 41..177 154 28.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17342-PA 186 GM17342-PA 4..186 2..184 959 95.6 Plus
Dsec\GM10799-PA 184 GM10799-PA 3..184 1..184 665 67.4 Plus
Dsec\GM17341-PA 186 GM17341-PA 18..186 16..184 571 59.2 Plus
Dsec\GM21225-PA 100 GM21225-PA 1..100 81..183 153 34.9 Plus
Dsec\GM16582-PA 268 GM16582-PA 152..262 48..172 141 29.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24201-PA 186 GD24201-PA 3..186 1..184 946 92.9 Plus
Dsim\GD19773-PA 184 GD19773-PA 3..184 1..184 667 67.4 Plus
Dsim\Lectin-galC1-PA 186 GD24200-PA 7..186 3..184 576 57.1 Plus
Dsim\GD24567-PA 188 GD24567-PA 28..188 19..183 261 35.5 Plus
Dsim\GD23749-PA 179 GD23749-PA 29..164 40..176 143 27.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19459-PA 194 GJ19459-PA 11..194 3..183 270 34.4 Plus
Dvir\GJ18331-PA 123 GJ18331-PA 1..121 45..175 230 38.9 Plus
Dvir\GJ24063-PA 173 GJ24063-PA 29..159 28..165 227 38.6 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 63..186 38..172 180 30.9 Plus
Dvir\GJ18255-PA 159 GJ18255-PA 36..158 41..172 174 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23836-PA 283 GK23836-PA 132..283 33..184 585 67.1 Plus
Dwil\GK23835-PA 187 GK23835-PA 5..187 2..184 577 56.8 Plus
Dwil\GK23834-PA 184 GK23834-PA 5..184 2..184 548 54.6 Plus
Dwil\GK23836-PA 283 GK23836-PA 1..128 8..135 398 55.5 Plus
Dwil\GK23821-PA 496 GK23821-PA 35..141 45..151 268 45.8 Plus
Dwil\GK23821-PA 496 GK23821-PA 163..254 41..131 251 50 Plus
Dwil\GK25689-PA 196 GK25689-PA 36..188 19..177 243 35.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13248-PA 186 GE13248-PA 3..186 1..184 833 81 Plus
Dyak\Lectin-galC1-PA 186 GE13247-PA 18..186 16..184 556 58.6 Plus
Dyak\GE17444-PA 188 GE17444-PA 3..188 1..183 272 33.5 Plus
Dyak\GE13249-PA 150 GE13249-PA 16..148 34..171 141 28.7 Plus

IP10378.hyp Sequence

Translation from 0 to 554

> IP10378.hyp
KTLVQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYV
FGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTS
GNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTE
FQLNDRPCHNHASSLFKYICEAPKQETVSIVVWK*

IP10378.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Da-PB 186 CG33532-PB 3..186 1..184 1013 100 Plus
lectin-37Da-PA 186 CG33532-PA 3..186 1..184 1013 100 Plus
Lectin-galC1-PB 186 CG9976-PB 3..186 1..184 583 57.1 Plus
Lectin-galC1-PA 186 CG9976-PA 3..186 1..184 583 57.1 Plus
CG12111-PB 188 CG12111-PB 28..180 19..177 272 36 Plus