Clone IP10424 Report

Search the DGRC for IP10424

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:104
Well:24
Vector:pOT2
Associated Gene/TranscriptCG11598-RB
Protein status:IP10424.pep: validated not full length
Preliminary Size:1206
Sequenced Size:1258

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11598 2005-01-01 Successful iPCR screen
CG11598 2008-04-29 Release 5.5 accounting
CG11598 2008-08-15 Release 5.9 accounting
CG11598 2008-12-18 5.12 accounting

Clone Sequence Records

IP10424.complete Sequence

1258 bp (1258 high quality bases) assembled on 2005-03-24

GenBank Submission: BT023410

> IP10424.complete
TACAAAGCGTTTGTCTTCTTTTGTCTCTATATTGACCTTGCCAAGGGACT
AATTACATCCGAAATTATAGCCTCGCACAACTATCCGGTAGAAGTACACA
CAGTGCTCACACGAGATGGGTATTTACTCGACGCGTTCCGGATACCGGGC
TCTAAATTTTGTCAGCAATCTGGACCAAAGCCGGCGGTTCTCTTTCAGCA
CGGAATGTCCGCGTCCTCGGACGTTTTCCTGCTAAACGGACCTCAGGATT
CATTGGCATTCATGTTGGCCGACGCCTGCTTCGATGTGTGGCTGAGTAAC
TCAAGGGGCACTCGGTATTCCCGACGCCACGTGTCTTTGGATCCCTCTGA
TGAGGCCTTCTGGCGCTTCAGCTGGCACGAGATTGGAACGGAGGACGTGG
CCGCTTTCATAGACTACATTCTGGACACCACGAAGCAGAGAGCGTTGCAC
TTCTTGGGTCACTCGCAGGGATGCACCACGCTGGTGGTGCTCCTCAGCAT
GCGACCGGAGTACAACAAGTTGGTCAAGACCGCAGTCCTATTAGCTCCGG
CTGTCTTTATGCGCCACACAAGCACCCTTTCGCAGACCGTCTTCAGGAGT
TTCATAATGGCCATGCCCGACAAGGAGTTCATGTACCACAACGGAGTTTT
AAACAAACTCTTGAGTAATGTATGCGGGCTATTCGTTGCCAGGGTGTTCT
GCACAACCTTCTTCTTGATTTCCAACGGAAAAATTTCCAAACACCTAAAC
ACAAGCGTTATTCCTCTGATTGCCGCCACGCTTCCTGCGGGAGTTTCTTC
TCGCCAGCCCAAGCACTTCATCCAGCTCACGGACAGCGGCAAGTTCAGAC
CATTCGATTTCGGGATCCTGAGGAACTTGATCAACTACAAGAGCCTAGAA
CCTCCAGACTATACTTTGAGCAACGTCCGTCCCCTGACGCCAGTCCACAT
ATTCTACAGCGACGATGATAGTTCGACAGCAAAGGAGGATATTCAAAACT
TTGCCGCCAGAGTGCCGGAGGTGGTGATGCACCGGATCTCAACACCGGGC
TGGCACCATACGGACTTCGTGCATTCCATGACCGTTGCTGACGTAATCAA
CAAGCCGGTCATTGAAATTTTTAGAAGCTTTGAGCGACTCAGCAGTCCTA
CATTTTTATGAAAGTAGTTTCCATATGAAATGATGAATGTCTTTAATGTT
GAATGAAAAATAACCTTTCACTTCATAAACGAATGTTCATTGAAAAAAAA
AAAAAAAA

IP10424.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11598-RB 1361 CG11598-RB 42..1285 1..1244 6220 100 Plus
CG18530-RA 1278 CG18530-RA 71..582 59..570 1705 88.8 Plus
CG18530-RA 1278 CG18530-RA 614..923 602..911 770 83.2 Plus
CG18530-RA 1278 CG18530-RA 991..1147 979..1135 440 85.3 Plus
CG11600-RA 1152 CG11600-RA 412..573 355..516 285 78.3 Plus
CG18530-RA 1278 CG18530-RA 934..980 922..968 175 91.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8460298..8460995 58..753 3425 99.7 Plus
chr3R 27901430 chr3R 8461060..8461548 754..1242 2445 100 Plus
chr3R 27901430 chr3R 8458745..8459439 59..753 1765 83.6 Plus
chr3R 27901430 chr3R 8459510..8459885 760..1135 1130 86.7 Plus
chr3R 27901430 chr3R 8460186..8460242 1..57 285 100 Plus
chr3R 27901430 chr3R 8462298..8462459 355..516 285 78.4 Plus
chr3R 27901430 chr3R 8464304..8464458 361..515 250 77.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12635035..12635730 58..753 3480 100 Plus
3R 32079331 3R 12635795..12636285 754..1244 2455 100 Plus
3R 32079331 3R 12633483..12634177 59..753 1765 83.6 Plus
3R 32079331 3R 12634248..12634623 760..1135 1130 86.7 Plus
3R 32079331 3R 12634923..12634979 1..57 285 100 Plus
3R 32079331 3R 12637033..12637194 355..516 285 78.4 Plus
3R 32079331 3R 12639039..12639193 361..515 235 76.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12375866..12376561 58..753 3480 100 Plus
3R 31820162 3R 12376626..12377116 754..1244 2455 100 Plus
3R 31820162 3R 12374314..12374825 59..570 1705 88.8 Plus
3R 31820162 3R 12375079..12375230 760..911 640 94.7 Plus
3R 31820162 3R 12375298..12375454 979..1135 440 85.3 Plus
3R 31820162 3R 12375754..12375810 1..57 285 100 Plus
3R 31820162 3R 12377864..12378025 355..516 285 78.3 Plus
3R 31820162 3R 12379954..12380024 445..515 190 84.5 Plus
3R 31820162 3R 12375241..12375287 922..968 175 91.4 Plus
Blast to na_te.dros performed on 2019-03-16 08:26:18 has no hits.

IP10424.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:27:25 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8460186..8460242 1..57 100 -> Plus
chr3R 8460298..8460995 58..753 99 -> Plus
chr3R 8461060..8461548 754..1242 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:51 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1167 1..1161 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:27 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1167 1..1161 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:22 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1167 1..1161 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:24 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1167 1..1161 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:40:44 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1167 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:57:35 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1248 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:27 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1248 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:22 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1248 1..1242 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:24 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1248 1..1242 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:40:44 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11598-RB 7..1248 1..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:25 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12634923..12634979 1..57 100 -> Plus
3R 12635035..12635730 58..753 100 -> Plus
3R 12635795..12636283 754..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:25 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12634923..12634979 1..57 100 -> Plus
3R 12635035..12635730 58..753 100 -> Plus
3R 12635795..12636283 754..1242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:25 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12634923..12634979 1..57 100 -> Plus
3R 12635035..12635730 58..753 100 -> Plus
3R 12635795..12636283 754..1242 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:22 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8460645..8460701 1..57 100 -> Plus
arm_3R 8460757..8461452 58..753 100 -> Plus
arm_3R 8461517..8462005 754..1242 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:20 Download gff for IP10424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12375866..12376561 58..753 100 -> Plus
3R 12376626..12377114 754..1242 100   Plus
3R 12375754..12375810 1..57 100 -> Plus

IP10424.pep Sequence

Translation from 0 to 1160

> IP10424.pep
YKAFVFFCLYIDLAKGLITSEIIASHNYPVEVHTVLTRDGYLLDAFRIPG
SKFCQQSGPKPAVLFQHGMSASSDVFLLNGPQDSLAFMLADACFDVWLSN
SRGTRYSRRHVSLDPSDEAFWRFSWHEIGTEDVAAFIDYILDTTKQRALH
FLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAVFMRHTSTLSQTVFRS
FIMAMPDKEFMYHNGVLNKLLSNVCGLFVARVFCTTFFLISNGKISKHLN
TSVIPLIAATLPAGVSSRQPKHFIQLTDSGKFRPFDFGILRNLINYKSLE
PPDYTLSNVRPLTPVHIFYSDDDSSTAKEDIQNFAARVPEVVMHRISTPG
WHHTDFVHSMTVADVINKPVIEIFRSFERLSSPTFL*

IP10424.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16783-PA 425 GF16783-PA 42..421 10..378 760 42.4 Plus
Dana\GF17111-PA 962 GF17111-PA 545..898 21..375 758 42.4 Plus
Dana\GF16784-PA 423 GF16784-PA 41..418 10..379 726 39.3 Plus
Dana\GF10345-PA 399 GF10345-PA 7..397 4..378 697 38.3 Plus
Dana\GF19577-PA 381 GF19577-PA 2..351 25..365 686 40.7 Plus
Dana\GF17111-PA 962 GF17111-PA 2..315 17..337 556 37 Plus
Dana\GF17111-PA 962 GF17111-PA 310..543 20..251 509 43.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19093-PA 383 GG19093-PA 3..380 1..378 1588 76.5 Plus
Dere\GG19115-PA 433 GG19115-PA 48..411 16..379 1117 53.8 Plus
Dere\GG19104-PA 386 GG19104-PA 35..385 15..383 941 46.9 Plus
Dere\GG11437-PA 422 GG11437-PA 31..416 1..378 741 40.6 Plus
Dere\GG24941-PA 406 GG24941-PA 35..405 19..379 714 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23213-PA 422 GH23213-PA 33..421 6..381 770 40.9 Plus
Dgri\GH23215-PA 564 GH23215-PA 33..419 6..379 742 39.8 Plus
Dgri\GH19443-PA 418 GH19443-PA 52..416 23..382 727 41.9 Plus
Dgri\GH19444-PA 424 GH19444-PA 33..419 6..379 727 39.3 Plus
Dgri\GH10558-PA 402 GH10558-PA 23..402 10..380 702 39.5 Plus
Dgri\GH23215-PA 564 GH23215-PA 421..562 246..382 294 39.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11598-PB 388 CG11598-PB 3..388 1..386 2022 100 Plus
CG18530-PA 389 CG18530-PA 3..381 1..379 1605 77.6 Plus
CG11608-PB 430 CG11608-PB 44..407 15..378 1048 49.5 Plus
CG11600-PB 406 CG11600-PB 46..402 22..378 979 49.6 Plus
CG31089-PA 421 CG31089-PA 39..415 10..378 734 41 Plus
CG31091-PC 424 CG31091-PC 46..422 10..378 691 39.8 Plus
CG31091-PB 424 CG31091-PB 46..422 10..378 691 39.8 Plus
mag-PA 399 CG5932-PA 4..397 5..378 678 36.7 Plus
CG3635-PB 425 CG3635-PB 50..419 18..378 670 38 Plus
CG2772-PA 416 CG2772-PA 24..408 10..378 666 39.4 Plus
CG8093-PB 398 CG8093-PB 26..392 14..371 607 34.4 Plus
CG8093-PA 398 CG8093-PA 26..392 14..371 607 34.4 Plus
CG6753-PB 405 CG6753-PB 39..402 23..379 602 37.4 Plus
CG11406-PB 396 CG11406-PB 36..384 31..372 578 38.4 Plus
CG18301-PA 422 CG18301-PA 44..407 17..382 576 35.3 Plus
Lip3-PA 394 CG8823-PA 30..394 21..378 574 36.2 Plus
CG31871-PA 531 CG31871-PA 77..438 17..378 566 35.3 Plus
Lip1-PB 439 CG7279-PB 66..413 17..373 559 35.4 Plus
Lip1-PA 439 CG7279-PA 66..413 17..373 559 35.4 Plus
CG11406-PA 326 CG11406-PA 2..314 67..372 536 38.4 Plus
Lip4-PB 432 CG6113-PB 69..428 17..378 530 32.5 Plus
Lip4-PA 434 CG6113-PA 69..430 17..378 523 32.1 Plus
Lip4-PC 448 CG6113-PC 83..444 17..378 523 32.1 Plus
CG7329-PB 457 CG7329-PB 40..390 17..378 522 32.9 Plus
CG7329-PA 457 CG7329-PA 40..390 17..378 522 32.9 Plus
CG18302-PA 406 CG18302-PA 41..402 17..378 497 33.3 Plus
CG31872-PB 1073 CG31872-PB 708..1069 11..373 482 31.5 Plus
CG31872-PA 1073 CG31872-PA 708..1069 11..373 482 31.5 Plus
CG18284-PB 457 CG18284-PB 91..452 11..373 470 31.5 Plus
CG18284-PC 457 CG18284-PC 91..452 11..373 470 31.5 Plus
CG3635-PC 301 CG3635-PC 50..231 18..195 466 48.4 Plus
CG17097-PB 1087 CG17097-PB 724..1078 17..371 448 31 Plus
CG11406-PD 266 CG11406-PD 2..127 67..192 360 54 Plus
CG11406-PC 266 CG11406-PC 2..127 67..192 360 54 Plus
Lip2-PA 413 CG17116-PA 36..403 19..377 353 29.1 Plus
Lip2-PB 377 CG17116-PB 4..367 23..377 350 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24674-PA 420 GI24674-PA 34..420 1..380 770 41.2 Plus
Dmoj\GI22981-PA 422 GI22981-PA 45..418 10..379 724 40.3 Plus
Dmoj\GI16796-PA 408 GI16796-PA 37..405 19..380 715 39 Plus
Dmoj\GI20075-PA 407 GI20075-PA 19..398 11..378 713 38.8 Plus
Dmoj\GI13397-PA 401 GI13397-PA 23..399 11..378 672 37.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27144-PA 396 GL27144-PA 24..390 19..382 824 44.4 Plus
Dper\GL27143-PA 396 GL27143-PA 24..390 19..382 819 43.8 Plus
Dper\GL22025-PA 425 GL22025-PA 30..423 3..382 762 40.9 Plus
Dper\GL21801-PA 422 GL21801-PA 30..420 3..382 741 39.7 Plus
Dper\GL18612-PA 410 GL18612-PA 39..409 19..381 732 41 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14975-PA 367 GA14975-PA 2..360 26..381 823 45.4 Plus
Dpse\GA22417-PA 363 GA22417-PA 2..356 26..378 819 43.4 Plus
Dpse\GA11091-PA 378 GA11091-PA 17..373 21..378 802 42.6 Plus
Dpse\GA15999-PA 425 GA15999-PA 30..423 3..382 762 41.2 Plus
Dpse\GA15458-PA 410 GA15458-PA 39..409 19..381 736 41 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24049-PA 388 GM24049-PA 3..387 1..385 1956 93.5 Plus
Dsec\GM24047-PA 391 GM24047-PA 3..381 1..379 1639 77.8 Plus
Dsec\GM24052-PA 430 GM24052-PA 43..408 14..379 1089 50.5 Plus
Dsec\GM24050-PA 475 GM24050-PA 45..346 21..342 833 48.4 Plus
Dsec\GM10277-PA 421 GM10277-PA 30..415 1..378 755 40.6 Plus
Dsec\GM24050-PA 475 GM24050-PA 357..469 141..253 526 88.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18848-PA 388 GD18848-PA 3..387 1..385 1982 94.8 Plus
Dsim\GD18847-PA 391 GD18847-PA 3..381 1..379 1651 77.8 Plus
Dsim\GD18851-PA 435 GD18851-PA 44..412 8..378 1081 49.6 Plus
Dsim\GD18849-PA 370 GD18849-PA 29..368 21..378 913 47.2 Plus
Dsim\GD21247-PA 421 GD21247-PA 30..415 1..378 748 40.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23893-PA 424 GJ23893-PA 34..419 1..379 784 41.3 Plus
Dvir\GJ24675-PA 422 GJ24675-PA 45..421 10..380 738 40.8 Plus
Dvir\GJ13469-PA 405 GJ13469-PA 19..396 11..378 725 39.3 Plus
Dvir\GJ23892-PA 421 GJ23892-PA 51..418 19..379 704 39.6 Plus
Dvir\GJ17195-PA 407 GJ17195-PA 23..404 10..380 702 38.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12870-PA 427 GK12870-PA 25..419 2..378 736 39.4 Plus
Dwil\GK15530-PA 410 GK15530-PA 26..404 10..378 726 40.9 Plus
Dwil\GK12869-PA 431 GK12869-PA 50..428 11..379 718 40.7 Plus
Dwil\GK24189-PA 451 GK24189-PA 71..442 18..378 710 39.6 Plus
Dwil\GK12291-PA 406 GK12291-PA 41..406 19..378 672 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26208-PA 388 GE26208-PA 3..381 1..379 1578 74.9 Plus
Dyak\GE26210-PA 435 GE26210-PA 43..416 7..382 1080 51.1 Plus
Dyak\GE26209-PA 387 GE26209-PA 42..381 21..378 926 48 Plus
Dyak\GE23632-PA 421 GE23632-PA 30..415 1..378 739 40.5 Plus
Dyak\GE18232-PA 410 GE18232-PA 35..402 19..378 725 40.9 Plus

IP10424.hyp Sequence

Translation from 0 to 1160

> IP10424.hyp
YKAFVFFCLYIDLAKGLITSEIIASHNYPVEVHTVLTRDGYLLDAFRIPG
SKFCQQSGPKPAVLFQHGMSASSDVFLLNGPQDSLAFMLADACFDVWLSN
SRGTRYSRRHVSLDPSDEAFWRFSWHEIGTEDVAAFIDYILDTTKQRALH
FLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAVFMRHTSTLSQTVFRS
FIMAMPDKEFMYHNGVLNKLLSNVCGLFVARVFCTTFFLISNGKISKHLN
TSVIPLIAATLPAGVSSRQPKHFIQLTDSGKFRPFDFGILRNLINYKSLE
PPDYTLSNVRPLTPVHIFYSDDDSSTAKEDIQNFAARVPEVVMHRISTPG
WHHTDFVHSMTVADVINKPVIEIFRSFERLSSPTFL*

IP10424.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG11598-PB 388 CG11598-PB 3..388 1..386 2022 100 Plus
CG18530-PA 389 CG18530-PA 3..381 1..379 1605 77.6 Plus
CG11608-PB 430 CG11608-PB 44..407 15..378 1048 49.5 Plus
CG11600-PB 406 CG11600-PB 46..402 22..378 979 49.6 Plus
CG31089-PA 421 CG31089-PA 39..415 10..378 734 41 Plus