Clone IP10429 Report

Search the DGRC for IP10429

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:104
Well:29
Vector:pOT2
Associated Gene/TranscriptCG11854-RB
Protein status:IP10429.pep: gold
Preliminary Size:1001
Sequenced Size:1029

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11854 2005-01-01 Successful iPCR screen
CG11854 2008-04-29 Release 5.5 accounting
CG11854 2008-08-15 Release 5.9 accounting
CG11854 2008-12-18 5.12 accounting

Clone Sequence Records

IP10429.complete Sequence

1029 bp (1029 high quality bases) assembled on 2011-05-11

GenBank Submission: BT023411.1

> IP10429.complete
CCAGCAATTATGGAGCTAACTCTCGCCCTCGTCCTGCTGTTCGGATGTGC
GTCCACCTACGGACACGCCTCCGATTTCCCCTCGGGCATCGAGAGGTGCG
CCATAATGGACGAGCAGTGCCTGGAGGACAGGGTGAACTTCGTGCTCAGG
AACTACGCCAAAAGCGGTATCAAGGAGCTGGGCTTGATCCCCCTCGATCC
GCTGCACGTCAAGAAGTTCAAAATCGGACGCAATCCGCACAGTCCGGTCA
ACATCGATCTCAGCTTCCACGAGATGGACATCTTGGGTCTGCATCAGGGA
GTTGCGAAGCGAGTGAGCGGATTCACAAGGGATCTCAGCCGCTCCATCGA
GCTGGTCATGGAAGTTCCAGAAATAGGAGTCAGAGGACCCTACTCGGTGG
ACGGAAGAATACTCATTCTGCCCATCACCGGAAATGGCATTGCTGACATA
CGCCTCACTAGAACAAAGGTACGTGCACAGATCAAATTGAAGCGCGTCTC
CAAGGGCGATCATCAAACCTACGCCGAGGTGATGAACATAAAGGTTGAGC
TGGATCCATCCCATGTGACCTACCAGCTGGAAAATCTGTTCAACGGCCAG
AAAGATCTCAGCGAGAACATGCACGCGCTTATCAATGAGAACTGGAAGGA
CATCTTCAATGAACTGAAACCGGGCATTGGCGAGGCCTTCGGACTGATAG
CCAAGTCGGTGGTGGACAGGATCTTTGGCAAACTGCCGCTCGAACAGCTC
TTTGTAGTCTAAGACCTTAGTACAAACACCCTAATTAGTCCAAACACAAA
TCGTAAATATTTATTTGACTTTCAAAATACAAATGCAAAGCAAATAAGAA
AAACTGGTAAGTTCCTCATACAAATAAAACGTAGTTGCAAAATAAATTCA
GGCACTAAAGGATTTCTTATTTCTAAAGTTTAAGTAAAATACAGATTTAT
AAAAGTGAAAAGCAAACACATTTGTAGTTTTGCCAAATAAATGTAAACAC
AGTTAAACTTAAAAAAAAAAAAAAAAAAA

IP10429.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11854.a 1040 CG11854.a 30..1040 1..1011 5055 100 Plus
bam-RA 2009 bam-RA 1785..2009 1011..787 1125 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21065794..21066346 458..1010 2750 99.8 Plus
chr3R 27901430 chr3R 21065288..21065525 80..317 1190 100 Plus
chr3R 27901430 chr3R 21065590..21065731 316..457 710 100 Plus
chr3R 27901430 chr3R 21065133..21065211 1..79 395 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25242710..25243263 458..1011 2770 100 Plus
3R 32079331 3R 25242204..25242441 80..317 1190 100 Plus
3R 32079331 3R 25242506..25242647 316..457 710 100 Plus
3R 32079331 3R 25242049..25242127 1..79 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24983541..24984094 458..1011 2770 100 Plus
3R 31820162 3R 24983035..24983272 80..317 1190 100 Plus
3R 31820162 3R 24983337..24983478 316..457 710 100 Plus
3R 31820162 3R 24982880..24982958 1..79 395 100 Plus
Blast to na_te.dros performed 2019-03-15 10:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 80..167 766..853 115 61.8 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1570..1657 853..766 115 61.8 Minus

IP10429.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:37:23 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21065592..21065731 318..457 100 -> Plus
chr3R 21065288..21065525 80..317 100 -> Plus
chr3R 21065133..21065211 1..79 100 -> Plus
chr3R 21065794..21066346 458..1010 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:53 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RA 1..762 1..762 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-05-19 09:25:21 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RA 1..762 1..762 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:21:30 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RB 1..753 10..762 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:53 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RA 1..762 1..762 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:08:12 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RB 1..753 10..762 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:05:05 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RA 1..1010 1..1010 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-05-19 09:25:21 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RA 1..1010 1..1010 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:21:30 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RB 30..1039 1..1010 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:53 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RA 1..1010 1..1010 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:12 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
CG11854-RB 30..1039 1..1010 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:23 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25242049..25242127 1..79 100 -> Plus
3R 25242204..25242441 80..317 100 -> Plus
3R 25242508..25242647 318..457 100 -> Plus
3R 25242710..25243262 458..1010 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:23 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25242049..25242127 1..79 100 -> Plus
3R 25242204..25242441 80..317 100 -> Plus
3R 25242508..25242647 318..457 100 -> Plus
3R 25242710..25243262 458..1010 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:37:23 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25242049..25242127 1..79 100 -> Plus
3R 25242204..25242441 80..317 100 -> Plus
3R 25242508..25242647 318..457 100 -> Plus
3R 25242710..25243262 458..1010 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:21:30 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21067771..21067849 1..79 100 -> Plus
arm_3R 21067926..21068163 80..317 100 -> Plus
arm_3R 21068230..21068369 318..457 100 -> Plus
arm_3R 21068432..21068984 458..1010 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:06:57 Download gff for IP10429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24983035..24983272 80..317 100 -> Plus
3R 24983339..24983478 318..457 100 -> Plus
3R 24983541..24984093 458..1010 100   Plus
3R 24982880..24982958 1..79 100 -> Plus

IP10429.pep Sequence

Translation from 0 to 761

> IP10429.pep
PAIMELTLALVLLFGCASTYGHASDFPSGIERCAIMDEQCLEDRVNFVLR
NYAKSGIKELGLIPLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQG
VAKRVSGFTRDLSRSIELVMEVPEIGVRGPYSVDGRILILPITGNGIADI
RLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQ
KDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQL
FVV*

IP10429.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17554-PA 254 GF17554-PA 1..252 4..253 941 69 Plus
Dana\GF17552-PA 250 GF17552-PA 9..248 10..252 353 34 Plus
Dana\GF20756-PA 251 GF20756-PA 20..250 19..252 320 34.3 Plus
Dana\GF17553-PA 248 GF17553-PA 6..245 8..251 311 31.8 Plus
Dana\GF21371-PA 263 GF21371-PA 32..260 26..251 303 27.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11380-PA 250 GG11380-PA 1..250 4..253 1180 89.6 Plus
Dere\GG11378-PA 250 GG11378-PA 1..248 3..252 376 34.1 Plus
Dere\GG11299-PA 251 GG11299-PA 5..250 7..252 331 33.5 Plus
Dere\GG11379-PA 248 GG11379-PA 18..246 24..252 322 31.3 Plus
Dere\GG18615-PA 260 GG18615-PA 1..257 4..251 269 29.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17382-PA 259 GH17382-PA 20..250 21..251 646 51.5 Plus
Dgri\GH17381-PA 246 GH17381-PA 18..245 24..252 435 33.6 Plus
Dgri\GH17380-PA 248 GH17380-PA 17..246 23..252 354 33.8 Plus
Dgri\GH18827-PA 250 GH18827-PA 6..249 7..252 319 33.3 Plus
Dgri\GH14735-PA 237 GH14735-PA 18..235 24..251 305 27.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG11854-PB 250 CG11854-PB 1..250 4..253 1284 100 Plus
CG11852-PA 250 CG11852-PA 1..248 3..252 372 34.3 Plus
CG13618-PA 252 CG13618-PA 6..251 6..252 327 32.4 Plus
to-PB 249 CG11853-PB 20..245 26..251 316 31.7 Plus
to-PA 249 CG11853-PA 20..245 26..251 316 31.7 Plus
CG17279-PD 245 CG17279-PD 1..243 8..251 315 28.6 Plus
CG2650-PA 260 CG2650-PA 29..257 26..251 288 29.1 Plus
CG31189-PB 258 CG31189-PB 1..249 4..252 236 25.8 Plus
CG31207-PA 258 CG31207-PA 6..248 8..252 213 26.2 Plus
CG17189-PC 271 CG17189-PC 19..248 16..246 211 24.6 Plus
CG17189-PB 271 CG17189-PB 19..248 16..246 211 24.6 Plus
CG10407-PB 259 CG10407-PB 59..256 49..250 205 24.8 Plus
CG10407-PA 259 CG10407-PA 59..256 49..250 205 24.8 Plus
CG10264-PA 270 CG10264-PA 75..264 55..246 203 26 Plus
CG14259-PA 289 CG14259-PA 52..264 26..246 203 25.7 Plus
CG14661-PB 246 CG14661-PB 1..246 4..253 198 27.8 Plus
CG14661-PA 246 CG14661-PA 1..246 4..253 198 27.8 Plus
CG14457-PB 271 CG14457-PB 2..248 2..246 198 25.2 Plus
CG7079-PB 255 CG7079-PB 23..249 27..252 196 24 Plus
CG7079-PA 255 CG7079-PA 23..249 27..252 196 24 Plus
CG10407-PC 263 CG10407-PC 59..260 49..250 193 24.3 Plus
CG14457-PC 270 CG14457-PC 28..247 27..246 189 25.1 Plus
CG2016-PD 249 CG2016-PD 8..244 10..249 187 24.4 Plus
CG2016-PB 249 CG2016-PB 8..244 10..249 187 24.4 Plus
CG14258-PA 258 CG14258-PA 24..253 22..250 183 23.8 Plus
CG2016-PE 254 CG2016-PE 8..249 10..249 172 23.9 Plus
CG2016-PC 183 CG2016-PC 33..178 105..249 163 27 Plus
CG14457-PA 144 CG14457-PA 3..121 127..246 143 29.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23926-PA 238 GI23926-PA 1..236 13..252 706 52.9 Plus
Dmoj\GI23925-PA 241 GI23925-PA 1..239 3..251 384 33.5 Plus
Dmoj\GI23924-PA 255 GI23924-PA 1..253 4..252 350 31.8 Plus
Dmoj\GI10085-PA 254 GI10085-PA 27..253 23..252 326 35.3 Plus
Dmoj\GI16254-PA 228 GI16254-PA 1..226 30..252 245 25.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11989-PA 256 GL11989-PA 21..256 18..253 846 65.3 Plus
Dper\GL11987-PA 250 GL11987-PA 1..248 3..252 378 33.9 Plus
Dper\GL11988-PA 251 GL11988-PA 4..247 6..253 330 30.9 Plus
Dper\GL21869-PA 240 GL21869-PA 16..239 22..252 316 35.2 Plus
Dper\GL12686-PA 243 GL12686-PA 1..241 8..251 304 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11238-PA 256 GA11238-PA 21..256 18..253 850 65.7 Plus
Dpse\GA11236-PA 250 GA11236-PA 1..248 3..252 378 33.9 Plus
Dpse\GA11237-PA 251 GA11237-PA 4..247 6..253 330 30.9 Plus
Dpse\GA12411-PA 253 GA12411-PA 26..252 23..252 321 34.5 Plus
Dpse\GA15409-PA 268 GA15409-PA 1..252 4..251 300 28 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17823-PA 246 GM17823-PA 1..246 4..253 1126 90.4 Plus
Dsec\GM17820-PA 250 GM17820-PA 1..248 3..252 383 33.9 Plus
Dsec\GM17822-PA 249 GM17822-PA 18..245 24..251 325 31.4 Plus
Dsec\GM18865-PA 260 GM18865-PA 1..257 4..251 301 29.1 Plus
Dsec\GM15110-PA 224 GM15110-PA 1..222 8..251 260 26.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21191-PA 250 GD21191-PA 1..250 4..253 1194 94.4 Plus
Dsim\GD21189-PA 250 GD21189-PA 1..248 3..252 387 34.3 Plus
Dsim\GD21190-PA 241 GD21190-PA 16..237 30..251 313 31.4 Plus
Dsim\GD24605-PA 260 GD24605-PA 15..257 13..251 289 28.7 Plus
Dsim\GD21326-PA 264 GD21326-PA 20..241 27..246 209 24.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24020-PA 255 GJ24020-PA 10..252 11..251 737 55.6 Plus
Dvir\GJ24018-PA 246 GJ24018-PA 18..244 24..251 411 34.2 Plus
Dvir\GJ24016-PA 251 GJ24016-PA 1..249 4..252 383 34.4 Plus
Dvir\GJ23820-PA 254 GJ23820-PA 5..253 1..252 336 34.2 Plus
Dvir\GJ24019-PA 245 GJ24019-PA 4..243 10..251 326 28.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13452-PA 254 GK13452-PA 8..252 10..252 773 55.5 Plus
Dwil\GK13450-PA 250 GK13450-PA 1..248 3..252 367 33.3 Plus
Dwil\GK13451-PA 244 GK13451-PA 6..242 6..246 342 34.4 Plus
Dwil\GK19974-PA 256 GK19974-PA 3..254 2..251 275 26.8 Plus
Dwil\GK14312-PA 253 GK14312-PA 4..249 3..252 225 25.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23577-PA 250 GE23577-PA 1..250 4..253 1205 90.8 Plus
Dyak\GE23575-PA 251 GE23575-PA 2..249 3..252 379 33.9 Plus
Dyak\GE25021-PA 245 GE25021-PA 1..243 8..251 337 29.4 Plus
Dyak\GE23494-PA 251 GE23494-PA 5..250 7..252 330 33.5 Plus
Dyak\to-PA 248 GE23576-PA 18..246 24..252 321 31.7 Plus

IP10429.hyp Sequence

Translation from 0 to 761

> IP10429.hyp
PAIMELTLALVLLFGCASTYGHASDFPSGIERCAIMDEQCLEDRVNFVLR
NYAKSGIKELGLIPLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQG
VAKRVSGFTRDLSRSIELVMEVPEIGVRGPYSVDGRILILPITGNGIADI
RLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQ
KDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQL
FVV*

IP10429.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG11854-PB 250 CG11854-PB 1..250 4..253 1284 100 Plus
CG11852-PA 250 CG11852-PA 1..248 3..252 372 34.3 Plus
CG13618-PA 252 CG13618-PA 6..251 6..252 327 32.4 Plus
to-PB 249 CG11853-PB 20..245 26..251 316 31.7 Plus
to-PA 249 CG11853-PA 20..245 26..251 316 31.7 Plus